BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30301 (766 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g25240.1 68415.m03020 serpin, putative / serine protease inhi... 57 1e-08 At2g26390.1 68415.m03167 serpin, putative / serine protease inhi... 56 2e-08 At3g45220.1 68416.m04880 serpin, putative / serine protease inhi... 56 3e-08 At1g63280.1 68414.m07154 serpin-related / serine protease inhibi... 51 1e-06 At2g14540.1 68415.m01628 serpin family protein / serine protease... 50 2e-06 At1g51330.1 68414.m05772 serpin-related / serine protease inhibi... 50 2e-06 At1g64030.1 68414.m07252 serpin family protein / serine protease... 49 3e-06 At1g47710.1 68414.m05302 serpin, putative / serine protease inhi... 48 5e-06 At2g35580.1 68415.m04357 serpin family protein / serine protease... 46 3e-05 At1g62170.1 68414.m07013 serpin family protein / serine protease... 45 5e-05 At1g72410.1 68414.m08374 COP1-interacting protein-related simila... 30 1.9 At1g33390.1 68414.m04133 helicase domain-containing protein simi... 30 1.9 At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containi... 29 2.6 At5g37490.1 68418.m04515 U-box domain-containing protein similar... 29 4.5 At3g54850.1 68416.m06077 armadillo/beta-catenin repeat family pr... 29 4.5 At3g11240.1 68416.m01367 arginine-tRNA-protein transferase, puta... 28 5.9 At1g51980.1 68414.m05863 mitochondrial processing peptidase alph... 28 5.9 >At2g25240.1 68415.m03020 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 324 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/61 (47%), Positives = 39/61 (63%) Frame = +1 Query: 526 DSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMMYKRGDYKYGESA 705 D++ S+T VL NA+YFKGAWSSKFD +T DF++ ++KVP M D +Y S Sbjct: 95 DTIRSSTL-VLANAVYFKGAWSSKFDANMTKKNDFHLLDGTSVKVPFMTNYED-QYLRSY 152 Query: 706 D 708 D Sbjct: 153 D 153 >At2g26390.1 68415.m03167 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 389 Score = 56.4 bits (130), Expect = 2e-08 Identities = 23/44 (52%), Positives = 29/44 (65%) Frame = +1 Query: 553 VLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMMYKRGD 684 +L NA+YFK AWS KFD +LT D DF++ T+KVP M D Sbjct: 168 ILANAVYFKAAWSRKFDAKLTKDNDFHLLDGNTVKVPFMMSYKD 211 >At3g45220.1 68416.m04880 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 393 Score = 55.6 bits (128), Expect = 3e-08 Identities = 26/65 (40%), Positives = 42/65 (64%), Gaps = 4/65 (6%) Frame = +1 Query: 511 DLVNPDSLSSATAAVLV--NAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM--YKR 678 ++++ DS+ + ++L+ NA+YFKGAWS KFD +LT DF++ +KVP M YK+ Sbjct: 152 EILSDDSIKTIRESMLILANAVYFKGAWSKKFDAKLTKSYDFHLLDGTMVKVPFMTNYKK 211 Query: 679 GDYKY 693 +Y Sbjct: 212 QYLEY 216 >At1g63280.1 68414.m07154 serpin-related / serine protease inhibitor-related similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885346 Length = 120 Score = 50.8 bits (116), Expect = 1e-06 Identities = 24/53 (45%), Positives = 33/53 (62%) Frame = +1 Query: 511 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 DL+ S+ S T V NA+YFKGAW +KFD+ T D +F+ K+ + VP M Sbjct: 30 DLLPRGSVKSETVQVYGNALYFKGAWENKFDKSSTKDNEFHQGKE--VHVPFM 80 >At2g14540.1 68415.m01628 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 407 Score = 50.0 bits (114), Expect = 2e-06 Identities = 20/47 (42%), Positives = 31/47 (65%) Frame = +1 Query: 529 SLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 S++S T + NA+YFKGAW FD+ +T D+ F++ K++ VP M Sbjct: 187 SVTSLTNWIYGNALYFKGAWEKAFDKSMTRDKPFHLLNGKSVSVPFM 233 >At1g51330.1 68414.m05772 serpin-related / serine protease inhibitor-related similar to serpin [Hordeum vulgare subsp. vulgare] CAA64599.1 GI:1197577 Length = 193 Score = 50.0 bits (114), Expect = 2e-06 Identities = 23/61 (37%), Positives = 38/61 (62%) Frame = +1 Query: 511 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMMYKRGDYK 690 +L+ P S+++ T + NA+YFKGAW +KF + +T + F++ K + VP M K + K Sbjct: 53 NLLPPGSVTNQTIKIYGNALYFKGAWENKFGKSMTIHKPFHLVNGKQVLVPFM-KSYERK 111 Query: 691 Y 693 Y Sbjct: 112 Y 112 >At1g64030.1 68414.m07252 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 [Cucurbita maxima] GI:9937311, serpin [Triticum aestivum] GI:871551; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 385 Score = 49.2 bits (112), Expect = 3e-06 Identities = 21/53 (39%), Positives = 31/53 (58%) Frame = +1 Query: 511 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 DL+ S++S T + NA+ FKGAW F++ T D DFY+ ++ VP M Sbjct: 153 DLLPDGSVTSLTNKIYANALSFKGAWKRPFEKYYTRDNDFYLVNGTSVSVPFM 205 >At1g47710.1 68414.m05302 serpin, putative / serine protease inhibitor, putative similar to phloem serpin-1 [Cucurbita maxima] GI:9937311; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 391 Score = 48.4 bits (110), Expect = 5e-06 Identities = 19/47 (40%), Positives = 27/47 (57%) Frame = +1 Query: 529 SLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 S S T + NA+YFKG W+ KFDE LT + +F++ + P M Sbjct: 158 SADSMTKLIFANALYFKGTWNEKFDESLTQEGEFHLLDGNKVTAPFM 204 >At2g35580.1 68415.m04357 serpin family protein / serine protease inhibitor family protein similar to protein zx [Hordeum vulgare subsp. vulgare] GI:19071, serpin [Triticum aestivum] GI:1885350; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 374 Score = 46.0 bits (104), Expect = 3e-05 Identities = 20/50 (40%), Positives = 29/50 (58%) Frame = +1 Query: 520 NPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 NP S + T + NA++F G W S+FD LT D DF++ ++VP M Sbjct: 157 NPKS-APLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFM 205 >At1g62170.1 68414.m07013 serpin family protein / serine protease inhibitor family protein similar to phloem serpin-1 GI:9937311 from [Cucurbita maxima]; contains Pfam profile PF00079: Serpin (serine protease inhibitor) Length = 433 Score = 45.2 bits (102), Expect = 5e-05 Identities = 19/53 (35%), Positives = 31/53 (58%) Frame = +1 Query: 511 DLVNPDSLSSATAAVLVNAIYFKGAWSSKFDERLTSDRDFYVSKDKTIKVPMM 669 DL+ S++S T V +A+YFKG W K+ + +T + FY+ ++ VP M Sbjct: 217 DLLPRGSVTSLTDRVYGSALYFKGTWEEKYSKSMTKCKPFYLLNGTSVSVPFM 269 >At1g72410.1 68414.m08374 COP1-interacting protein-related similar to COP1-Interacting ProteinI 7 (CIP7) [Arabidopsis thaliana] GI:3327870 Length = 1163 Score = 29.9 bits (64), Expect = 1.9 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -3 Query: 176 REDNAFPWIIFHYFGKHSGCEVIVSIFEYIREICDG 69 R D +++F KHS CE+ VS E ++ G Sbjct: 2 RSDTVLDYVVFELSPKHSKCELFVSSNEQTEKLASG 37 >At1g33390.1 68414.m04133 helicase domain-containing protein similar to kurz protein [Drosophila melanogaster] GI:5869803; contains Pfam profiles PF04408: Helicase associated domain (HA2), PF00271: Helicase conserved C-terminal domain Length = 1237 Score = 29.9 bits (64), Expect = 1.9 Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 2/46 (4%) Frame = +3 Query: 135 EVVKN--NPGKSVVLSAFSVLPPLAQLALASDGETHEELLKASASL 266 E VKN +PGK VL +++L P AQL + + E E L+ + ++ Sbjct: 636 EQVKNKFSPGKLRVLPLYAMLSPAAQLRVFEEVEKEERLVVVATNV 681 >At2g02750.1 68415.m00218 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 613 Score = 29.5 bits (63), Expect = 2.6 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -3 Query: 173 EDNAFPWIIFHYFGKHSGCEVIVSIFEYIRE 81 +D F ++ +GKH CE + IFE +RE Sbjct: 434 KDPVFWNVMISGYGKHGECESAIEIFELLRE 464 >At5g37490.1 68418.m04515 U-box domain-containing protein similar to immediate-early fungal elicitor protein CMPG1 [Petroselinum crispum] GI:14582200; contains Pfam profile PF04564: U-box domain Length = 435 Score = 28.7 bits (61), Expect = 4.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 200 ERRQHRKCREDNAFPWIIFHYFGKHSGCEVIVSIFEYI 87 E ++RKC +N+ W++ F K SG E + + I Sbjct: 153 ESEKNRKCVNENSVGWVLCDCFDKFSGDEKLTFMLNEI 190 >At3g54850.1 68416.m06077 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 632 Score = 28.7 bits (61), Expect = 4.5 Identities = 31/101 (30%), Positives = 48/101 (47%), Gaps = 7/101 (6%) Frame = +3 Query: 51 AIAAMAAVTNLSNVLKNGN----DNFTARMFT-EVVKNNPGKSVVLSAFSVLPPLAQLAL 215 AI A+T++ VLKNG+ +N A +F+ V+ N V + A + L ++L Sbjct: 423 AIVDAGAITDIVEVLKNGSMEARENAAATLFSLSVIDEN---KVAIGAAGAIQAL--ISL 477 Query: 216 ASDGETHEELLKASASLTTMLYEQN-SR-VKAVIFDQLKAL 332 +G + A+A +Y+ N SR VK I D L L Sbjct: 478 LEEGTRRGKKDAATAIFNLCIYQGNKSRAVKGGIVDPLTRL 518 >At3g11240.1 68416.m01367 arginine-tRNA-protein transferase, putative / arginyltransferase, putative / arginyl-tRNA-protein transferase, putative similar to SP|Q9ZT48 Arginine-tRNA-protein transferase 1 (EC 2.3.2.8) (R-transferase 1) (Arginyltransferase 1) (Arginyl-tRNA--protein transferase 1) {Arabidopsis thaliana}; contains Pfam profiles PF04377: Arginine-tRNA-protein transferase C terminus, PF04376: Arginine-tRNA-protein transferase N terminus Length = 605 Score = 28.3 bits (60), Expect = 5.9 Identities = 11/30 (36%), Positives = 21/30 (70%) Frame = -2 Query: 327 PLIDRRSRLLLANSVRIASSSGKPKLSKAL 238 PL+D++ +L+N +++SSS P+ S+ L Sbjct: 481 PLLDKKPYSVLSNISKVSSSSSSPQASETL 510 >At1g51980.1 68414.m05863 mitochondrial processing peptidase alpha subunit, putative similar to mitochondrial processing peptidase alpha subunit, mitochondrial precursor, Alpha-MPP (Ubiquinol-cytochrome C reductase subunit II) [Potato] SWISS-PROT:P29677 Length = 503 Score = 28.3 bits (60), Expect = 5.9 Identities = 13/26 (50%), Positives = 18/26 (69%) Frame = +3 Query: 201 AQLALASDGETHEELLKASASLTTML 278 A++ LA+ G HEELLK + LT+ L Sbjct: 256 ARMVLAASGVEHEELLKVAEPLTSDL 281 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,386,155 Number of Sequences: 28952 Number of extensions: 305010 Number of successful extensions: 975 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 975 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1712086600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -