BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30299 (767 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom... 26 6.8 SPCC1840.07c |||phosphoprotein phosphatase |Schizosaccharomyces ... 26 6.8 >SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pombe|chr 2|||Manual Length = 1692 Score = 25.8 bits (54), Expect = 6.8 Identities = 10/16 (62%), Positives = 13/16 (81%) Frame = -2 Query: 52 SSIATLNTEVSPPQFC 5 SS+A +N EVSPP+ C Sbjct: 1315 SSLARMNREVSPPKGC 1330 >SPCC1840.07c |||phosphoprotein phosphatase |Schizosaccharomyces pombe|chr 3|||Manual Length = 332 Score = 25.8 bits (54), Expect = 6.8 Identities = 15/58 (25%), Positives = 26/58 (44%) Frame = +2 Query: 455 LYFHSLASXXXXXXXXXXXXIIRTLLTLQLIHKLSPNFRKSVLRNQQRKLWIETALCT 628 +++ LA + +TL +L+ +P F V R + R L I+T LC+ Sbjct: 244 MWYRGLAQLSEEEACEVALNVTKTLNVNRLVMGHTPQFHGIVSRCEGRILLIDTGLCS 301 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,356,944 Number of Sequences: 5004 Number of extensions: 72575 Number of successful extensions: 164 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 164 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -