BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30299 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_02_0440 - 10273032-10273259,10273423-10273461,10273875-102741... 31 1.0 06_03_1235 + 28593906-28594412,28594670-28594756,28594890-285950... 30 1.8 02_05_0023 + 25138709-25138823,25139013-25139197,25139268-251393... 29 3.1 06_03_0196 - 17784747-17784833,17786061-17786333,17787982-177881... 29 4.1 01_07_0036 + 40647046-40647100,40647120-40647571,40648135-406482... 29 5.4 11_06_0313 + 22306497-22308938 28 7.1 09_04_0375 - 17055024-17055956,17056045-17056296 28 7.1 10_08_0392 + 17500748-17500877,17501006-17501280,17501321-175013... 28 9.4 02_04_0577 - 24011542-24011906,24012285-24012385,24013029-240132... 28 9.4 02_04_0061 + 19361562-19363130 28 9.4 01_01_0098 + 744582-745380,746107-746130,746500-747569 28 9.4 >02_02_0440 - 10273032-10273259,10273423-10273461,10273875-10274123, 10274203-10274329,10275009-10275251,10275359-10275457, 10275566-10275681,10275813-10276039,10276164-10276276, 10276402-10276522,10276641-10276855,10277042-10277225, 10277739-10278048,10278155-10278249,10278473-10278485 Length = 792 Score = 31.1 bits (67), Expect = 1.0 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = -3 Query: 144 DLWPGQTL--RPEVDNIVYLQSCRRPLSRDDCIHQSQL 37 D+W G+TL P V+N YL+ ++ +R +HQ +L Sbjct: 456 DVWIGKTLYRMPIVNNATYLELAKQDFNRCQALHQHEL 493 >06_03_1235 + 28593906-28594412,28594670-28594756,28594890-28595027, 28595752-28595771,28595772-28595967,28596104-28596168, 28596299-28596404 Length = 372 Score = 30.3 bits (65), Expect = 1.8 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -3 Query: 654 DTGRVHEPKVHNAVSIHSFRC*LRSTLFRKFGDSLWI 544 + G+ PK H V+ H FR + + K GD W+ Sbjct: 145 EIGKEKPPKEHAVVAAHQFRWLVSQVTYPKLGDLCWL 181 >02_05_0023 + 25138709-25138823,25139013-25139197,25139268-25139335, 25139729-25140041,25140621-25140962,25140990-25141079 Length = 370 Score = 29.5 bits (63), Expect = 3.1 Identities = 13/36 (36%), Positives = 22/36 (61%) Frame = +1 Query: 598 EAMDRNGIMYFGLMNPPSIWCWNSATGFSPKNFYKI 705 +A+D ++ FGL+N SI N + GF+ FY++ Sbjct: 66 KAIDGQTVILFGLLNGTSIGLLNLSLGFNSIGFYQM 101 >06_03_0196 - 17784747-17784833,17786061-17786333,17787982-17788166, 17788267-17788381 Length = 219 Score = 29.1 bits (62), Expect = 4.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 598 EAMDRNGIMYFGLMNPPSIWCWNSATGFSPKNFYK 702 +A+D ++ FGL+N SI N + GF+ FY+ Sbjct: 66 KAIDGQTVILFGLLNGTSIGLLNLSLGFNSIGFYQ 100 >01_07_0036 + 40647046-40647100,40647120-40647571,40648135-40648257, 40648407-40648461,40648613-40648722,40649352-40649531, 40650003-40650101,40651182-40651280,40652195-40652289, 40652290-40652378,40652739-40652901,40653299-40653404, 40655647-40655829,40656059-40656286,40656373-40656486 Length = 716 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -3 Query: 444 RPVRYGDRAIPRTPSIKSKDSPSIVNVP 361 +PVR GD A R PS + K P+I P Sbjct: 100 KPVRMGDAASERKPSSEGKPMPAIAAEP 127 >11_06_0313 + 22306497-22308938 Length = 813 Score = 28.3 bits (60), Expect = 7.1 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 6/45 (13%) Frame = -3 Query: 456 RKRSRPVRYGDRAIPRTPSIKSK------DSPSIVNVPREG*GKK 340 RKR RP R D A P I+SK +PS V +P +G K+ Sbjct: 208 RKRGRPRRVQDGADTSAPPIQSKYNEPVLQTPSAVTLPEDGKRKR 252 >09_04_0375 - 17055024-17055956,17056045-17056296 Length = 394 Score = 28.3 bits (60), Expect = 7.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 348 GKKYLLVTLHERSLATSKTSSPNP 277 G+K LL +H R +++ T+SP+P Sbjct: 104 GEKQLLTEIHRRKTSSASTASPSP 127 >10_08_0392 + 17500748-17500877,17501006-17501280,17501321-17501388, 17501516-17501632,17501802-17501943,17502622-17502912, 17503507-17503650 Length = 388 Score = 27.9 bits (59), Expect = 9.4 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +1 Query: 595 AEAMDRNGIMYFGLMNPPSIWCWNSATGFSPKNFYK 702 A+ +D ++ FGL+N SI N GF+ FY+ Sbjct: 86 AKPIDAQTVISFGLLNGISIGLLNLCLGFNSVGFYQ 121 >02_04_0577 - 24011542-24011906,24012285-24012385,24013029-24013287, 24014176-24014264,24015331-24015419 Length = 300 Score = 27.9 bits (59), Expect = 9.4 Identities = 24/81 (29%), Positives = 36/81 (44%), Gaps = 2/81 (2%) Frame = -3 Query: 456 RKRSRPVRYGDRAIPRTPSIKSKDSPSIVNV-PREG*GKKYLLVTLHERSLATSKTSSPN 280 R RSR RY R+ R+P + S + PR+ K+ + A S + SP Sbjct: 118 RSRSRSPRYRGRSRSRSPRYRRSPSYGRRSYSPRDRSPKRRSYSRSPPPARARSYSRSPP 177 Query: 279 PDTSATYTMC-*RNLPGTQVL 220 P +A + C RN+ G +L Sbjct: 178 PPRAALFACCGCRNIRGLHML 198 >02_04_0061 + 19361562-19363130 Length = 522 Score = 27.9 bits (59), Expect = 9.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 629 KYIMPFRSIASAADCEVRSSGN 564 K +PF SAADCEVR + N Sbjct: 378 KEFLPFEHSPSAADCEVRCARN 399 >01_01_0098 + 744582-745380,746107-746130,746500-747569 Length = 630 Score = 27.9 bits (59), Expect = 9.4 Identities = 16/37 (43%), Positives = 23/37 (62%), Gaps = 5/37 (13%) Frame = +2 Query: 254 IVYVADVSGFGLLVLD-VANDRSW----RVTNKYFFP 349 I Y +DV FG+LVL+ V+ RSW + N+ +FP Sbjct: 516 ISYKSDVYSFGMLVLEMVSGRRSWDPSIKNQNEVYFP 552 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,876,855 Number of Sequences: 37544 Number of extensions: 472554 Number of successful extensions: 1236 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 1193 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1235 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -