BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30299 (767 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_20781| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) 35 0.083 SB_3684| Best HMM Match : fn3 (HMM E-Value=8e-11) 33 0.34 SB_46289| Best HMM Match : DUF1690 (HMM E-Value=0.32) 28 7.2 SB_57594| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.5 SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) 28 9.5 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 28 9.5 SB_13721| Best HMM Match : C1_1 (HMM E-Value=1.1) 28 9.5 >SB_20781| Best HMM Match : zf-CCHC (HMM E-Value=0.0016) Length = 391 Score = 34.7 bits (76), Expect = 0.083 Identities = 20/60 (33%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = +3 Query: 102 YCPPQVLAFDLATDRLVYRHVVNISSYTSPSLFITP-VVDVRPEFPGDCANTSYTSPTCL 278 Y P +L D Y V + +YT+PS+ +P V D+ +P C +T YT+P+ L Sbjct: 275 YMAPSILTSPKVADIGSYWPVKCVYTYTAPSILTSPKVADIGSYWPVKCVHT-YTAPSIL 333 Score = 30.3 bits (65), Expect = 1.8 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%) Frame = +3 Query: 153 YRHVVNISSYTSPSLFITP-VVDVRPEFPGDCANTSYTSPTCL 278 Y V + +YT+PS+F +P V D+ +P C T YT+P+ L Sbjct: 214 YWPVKCVYTYTAPSIFTSPKVADIGFYWPVKCVYT-YTAPSIL 255 Score = 29.9 bits (64), Expect = 2.4 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = +3 Query: 102 YCPPQVLAFDLATDRLVYRHVVNISSYTSPSLFITP-VVDVRPEFPGDCANTSYTSPTCL 278 Y P + D Y V + +YT+PS+ +P V D+ +P C T Y +P+ L Sbjct: 223 YTAPSIFTSPKVADIGFYWPVKCVYTYTAPSILTSPKVADIGSYWPVKCVYT-YMAPSIL 281 >SB_3684| Best HMM Match : fn3 (HMM E-Value=8e-11) Length = 862 Score = 32.7 bits (71), Expect = 0.34 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = -2 Query: 760 YYSPLLAH*QIAGFLCQQRSCKSSWEKIPLLNSSTRY 650 +Y P + ++ GFL Q R+ SSW+++ L + TR+ Sbjct: 482 WYGPYVLPGKLTGFLVQWRNTYSSWQRVQLPANQTRF 518 >SB_46289| Best HMM Match : DUF1690 (HMM E-Value=0.32) Length = 947 Score = 28.3 bits (60), Expect = 7.2 Identities = 14/33 (42%), Positives = 20/33 (60%), Gaps = 2/33 (6%) Frame = -3 Query: 369 NVPREG*GKKY--LLVTLHERSLATSKTSSPNP 277 ++PR G G Y + T+ S ATS +SSP+P Sbjct: 854 SIPRSGSGNSYSVMATTIPTSSSATSDSSSPHP 886 >SB_57594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1386 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 302 VANDRSWRVTNKYFFPYPSRGTFTID 379 +A + WR TN++F SR TFT D Sbjct: 8 LAAKQRWRKTNEFFSENTSRATFTKD 33 >SB_37419| Best HMM Match : Pox_A32 (HMM E-Value=0.24) Length = 1497 Score = 27.9 bits (59), Expect = 9.5 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 4/63 (6%) Frame = +2 Query: 284 GLLVLDVANDRSW-RVTNKYFFPYPSRGTFTIDGESFDLMDGVLGMALSPYRT-GRD--R 451 GLL+L V +W R + K+ +P TIDG G+L + + PY RD + Sbjct: 807 GLLLLFVEPYTAWARDSEKFMYPDIKSVRVTIDGVPNKSKSGLLLLFVEPYTAWARDSEK 866 Query: 452 FLY 460 F+Y Sbjct: 867 FMY 869 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 27.9 bits (59), Expect = 9.5 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -3 Query: 423 RAIPRTPSIKSKDSPSIVNVPREG*GKKYLLVTLHERSLATSKTSSPNPDT 271 R+IP +P S S S++ PR+ + L L E + T SP PDT Sbjct: 2339 RSIPSSPPFASPKSSSVMQQPRKM-SSRSLATALSEGVIVTPLQPSP-PDT 2387 >SB_13721| Best HMM Match : C1_1 (HMM E-Value=1.1) Length = 256 Score = 27.9 bits (59), Expect = 9.5 Identities = 12/26 (46%), Positives = 16/26 (61%) Frame = +2 Query: 302 VANDRSWRVTNKYFFPYPSRGTFTID 379 +A + WR TN++F SR TFT D Sbjct: 8 LAAKQRWRKTNEFFSENTSRATFTKD 33 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 25,222,046 Number of Sequences: 59808 Number of extensions: 550672 Number of successful extensions: 1167 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1107 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1167 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2083999566 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -