BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30299 (767 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g48970.1 68414.m05489 eukaryotic translation initiation facto... 30 2.0 At4g21630.1 68417.m03135 subtilase family protein contains simil... 29 2.6 At3g11900.1 68416.m01459 amino acid transporter family protein l... 28 6.0 >At1g48970.1 68414.m05489 eukaryotic translation initiation factor 2B family protein / eIF-2B family protein similar to guanine nucleotide exchange factor, eIF-2B, delta subunit [Mus musculus] GI:529428; contains Pfam profile PF01008: Initiation factor 2 subunit family Length = 756 Score = 29.9 bits (64), Expect = 2.0 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 3/58 (5%) Frame = +1 Query: 544 DPQAIAEFPEERTSQSAAEAMDRN-GIMYFGLM--NPPSIWCWNSATGFSPKNFYKIA 708 DP A+A P RT+ ++ MD N + + LM + PS + + + NF+ ++ Sbjct: 681 DPDAVANIPSFRTNAKHSKTMDNNKNLQFLNLMYDSTPSEYISMIVSDYGMSNFHLVS 738 >At4g21630.1 68417.m03135 subtilase family protein contains similarity to subtilase; SP1 GI:9957714 from [Oryza sativa] Length = 772 Score = 29.5 bits (63), Expect = 2.6 Identities = 10/31 (32%), Positives = 21/31 (67%) Frame = -3 Query: 717 FVNSDLVKVLGRKSRC*IPAPDTGRVHEPKV 625 +++S + +VLG+K++C IP P ++ P + Sbjct: 646 YIDSSISRVLGKKTKCTIPKPSILDINLPSI 676 >At3g11900.1 68416.m01459 amino acid transporter family protein low similarity to proton/amino acid transporter 1 [Mus musculus] GI:21908024; belongs to INTERPRO:IPR002422 amino acid/polyamine transporter, family II Length = 432 Score = 28.3 bits (60), Expect = 6.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 139 QIDLCIGMSSTYQVTLHPL 195 QI LC+G++ T+ + +HPL Sbjct: 298 QIGLCVGLTFTFPIMVHPL 316 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,629,055 Number of Sequences: 28952 Number of extensions: 381406 Number of successful extensions: 967 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 939 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 967 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1721869952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -