BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30298 (396 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28441| Best HMM Match : GLTT (HMM E-Value=3.7e-28) 29 1.0 SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.8 SB_39168| Best HMM Match : Cgr1 (HMM E-Value=0.79) 27 4.2 SB_31052| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-14) 27 4.2 SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.3 SB_10748| Best HMM Match : GETHR (HMM E-Value=1.5) 27 7.3 SB_44729| Best HMM Match : SET (HMM E-Value=0) 26 9.6 SB_754| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.6 >SB_28441| Best HMM Match : GLTT (HMM E-Value=3.7e-28) Length = 447 Score = 29.5 bits (63), Expect = 1.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYIC 173 G+C+ G C G C+ G+C IC Sbjct: 391 GICTTGICTTGICTTGICTTGIC 413 Score = 29.5 bits (63), Expect = 1.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYIC 173 G+C+ G C G C+ G+C IC Sbjct: 396 GICTTGICTTGICTTGICTTGIC 418 Score = 29.5 bits (63), Expect = 1.0 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYIC 173 G+C+ G C G C+ G+C IC Sbjct: 401 GICTTGICTTGICTTGICTTGIC 423 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = -2 Query: 380 LHCIYKVLIGAHRDDNAYTADHLET 306 L C+Y LI H DD A TAD +ET Sbjct: 7 LACVYSALI-LHDDDVAITADKIET 30 >SB_39168| Best HMM Match : Cgr1 (HMM E-Value=0.79) Length = 358 Score = 27.5 bits (58), Expect = 4.2 Identities = 14/37 (37%), Positives = 19/37 (51%) Frame = +2 Query: 2 RRDYYRTKKKHNKTEITKRNKTNKYLQETTLSADVPR 112 +R R KK KT + K N+YL E T D+P+ Sbjct: 76 KRAAERILKKAEKTHKQRVEKFNEYLDELTEHYDIPK 112 >SB_31052| Best HMM Match : 7tm_1 (HMM E-Value=5.8e-14) Length = 283 Score = 27.5 bits (58), Expect = 4.2 Identities = 11/14 (78%), Positives = 12/14 (85%) Frame = -1 Query: 264 CSSSLDRPVFVRPA 223 CS S DRPVFV+PA Sbjct: 270 CSCSRDRPVFVQPA 283 >SB_44095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3051 Score = 27.1 bits (57), Expect = 5.5 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -3 Query: 274 RADVLIVTRSPGLCSPGFC*PGHCSRGLCLWYICRL 167 R + +V GLC G C G C GLC +C L Sbjct: 1672 RWSLCLVLCGLGLCCLGLCGLGLCGLGLCGLGLCGL 1707 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1688 GLCGLGLCGLGLCGLGLCGLGLCGL 1712 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1693 GLCGLGLCGLGLCGLGLCGLGLCGL 1717 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1698 GLCGLGLCGLGLCGLGLCGLGLCGL 1722 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1703 GLCGLGLCGLGLCGLGLCGLGLCGL 1727 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1708 GLCGLGLCGLGLCGLGLCGLGLCGL 1732 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1713 GLCGLGLCGLGLCGLGLCGLGLCGL 1737 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 241 GLCSPGFC*PGHCSRGLCLWYICRL 167 GLC G C G C GLC +C L Sbjct: 1718 GLCGLGLCGLGLCGLGLCGLGLCGL 1742 >SB_50937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2480 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 2 RRDYYRTKKKHNKTEITKRNKTNKYLQET 88 ++D TKK+ +T+ TK ++TNK +QET Sbjct: 1332 KKDVQETKKEVQETK-TKVDETNKEVQET 1359 >SB_10566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1264 Score = 26.6 bits (56), Expect = 7.3 Identities = 13/29 (44%), Positives = 21/29 (72%) Frame = +2 Query: 2 RRDYYRTKKKHNKTEITKRNKTNKYLQET 88 ++D TKK+ +T+ TK ++TNK +QET Sbjct: 238 KKDVQETKKEVQETK-TKVDETNKEVQET 265 >SB_10748| Best HMM Match : GETHR (HMM E-Value=1.5) Length = 126 Score = 26.6 bits (56), Expect = 7.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +2 Query: 185 QTQAARTMAGLTKAGRTKTGRSSD 256 +T+ +T G TK G+TK GR+ D Sbjct: 28 KTKDGKTRDGKTKDGKTKDGRTKD 51 >SB_44729| Best HMM Match : SET (HMM E-Value=0) Length = 1112 Score = 26.2 bits (55), Expect = 9.6 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +3 Query: 54 KETKQINTCRKPLCRQMYHE 113 ++T + C +PLC + YH+ Sbjct: 463 RQTGDVKACSQPLCSKFYHK 482 >SB_754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 123 Score = 26.2 bits (55), Expect = 9.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 172 GRCTTNTGRANNGRANKSRANKDRAIE 252 G TTN + NNGR +S N+ RAI+ Sbjct: 57 GSTTTNGSKTNNGR--QSATNRRRAID 81 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,564,553 Number of Sequences: 59808 Number of extensions: 186485 Number of successful extensions: 551 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 467 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -