BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30298 (396 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X54559-1|CAB56793.1| 1390|Homo sapiens proto-oncogene protein. 29 7.4 J02958-1|AAA59591.1| 1408|Homo sapiens MET protein. 29 7.4 BC130420-1|AAI30421.1| 1390|Homo sapiens met proto-oncogene (hep... 29 7.4 AC002080-1|AAB54047.1| 754|Homo sapiens receptor protein tyrosi... 29 7.4 >X54559-1|CAB56793.1| 1390|Homo sapiens proto-oncogene protein. Length = 1390 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 285 GTRHVRTCSSSLDRPVFVRPAFVSPAIVRA-ACVCGT 178 G RH ++CS L P FV+ + VR+ C+ GT Sbjct: 519 GCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGT 555 >J02958-1|AAA59591.1| 1408|Homo sapiens MET protein. Length = 1408 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 285 GTRHVRTCSSSLDRPVFVRPAFVSPAIVRA-ACVCGT 178 G RH ++CS L P FV+ + VR+ C+ GT Sbjct: 519 GCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGT 555 >BC130420-1|AAI30421.1| 1390|Homo sapiens met proto-oncogene (hepatocyte growth factor receptor) protein. Length = 1390 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 285 GTRHVRTCSSSLDRPVFVRPAFVSPAIVRA-ACVCGT 178 G RH ++CS L P FV+ + VR+ C+ GT Sbjct: 519 GCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGT 555 >AC002080-1|AAB54047.1| 754|Homo sapiens receptor protein tyrosine kinase protein. Length = 754 Score = 28.7 bits (61), Expect = 7.4 Identities = 14/37 (37%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -1 Query: 285 GTRHVRTCSSSLDRPVFVRPAFVSPAIVRA-ACVCGT 178 G RH ++CS L P FV+ + VR+ C+ GT Sbjct: 519 GCRHFQSCSQCLSAPPFVQCGWCHDKCVRSEECLSGT 555 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 46,287,148 Number of Sequences: 237096 Number of extensions: 814047 Number of successful extensions: 2414 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 2206 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2412 length of database: 76,859,062 effective HSP length: 82 effective length of database: 57,417,190 effective search space used: 2813442310 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -