BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30298 (396 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin pr... 22 2.9 AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. 22 2.9 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 21 5.1 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 21 5.1 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 20 9.0 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 20 9.0 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 20 9.0 >AY496432-1|AAS75803.1| 95|Apis mellifera defensin/royalisin precursor protein. Length = 95 Score = 21.8 bits (44), Expect = 2.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 211 GHCSRGLCLWYICR 170 GHC +G+C ICR Sbjct: 72 GHCEKGVC---ICR 82 >AJ308527-1|CAC33429.1| 57|Apis mellifera defensin protein. Length = 57 Score = 21.8 bits (44), Expect = 2.9 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 211 GHCSRGLCLWYICR 170 GHC +G+C ICR Sbjct: 47 GHCEKGVC---ICR 57 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.0 bits (42), Expect = 5.1 Identities = 7/18 (38%), Positives = 13/18 (72%) Frame = +1 Query: 16 QDKEKAQQNRNYEKKQNK 69 +++E ++NR YEK N+ Sbjct: 8 RNREYREKNRRYEKLHNE 25 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.2 bits (40), Expect = 9.0 Identities = 11/34 (32%), Positives = 12/34 (35%) Frame = +3 Query: 15 TGQRKSTTKQKLRKETKQINTCRKPLCRQMYHEH 116 T + K TKQ L Q P Q H H Sbjct: 537 TEEEKKKTKQSLSPSENQSKMEILPKTTQRQHHH 570 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 20.2 bits (40), Expect = 9.0 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = -2 Query: 329 YTADHLETSDLIPIEAPVTCG 267 Y +++ + IP+ P+ CG Sbjct: 105 YYKNYIINIEQIPVPVPIYCG 125 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 20.2 bits (40), Expect = 9.0 Identities = 6/21 (28%), Positives = 12/21 (57%) Frame = -2 Query: 329 YTADHLETSDLIPIEAPVTCG 267 Y +++ + IP+ P+ CG Sbjct: 346 YYKNYIINIEQIPVPVPIYCG 366 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 90,579 Number of Sequences: 438 Number of extensions: 1618 Number of successful extensions: 12 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 146,343 effective HSP length: 52 effective length of database: 123,567 effective search space used: 9761793 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -