BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30298 (396 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g02816.1 68414.m00241 expressed protein contains Pfam profile... 31 0.37 At5g45650.1 68418.m05613 subtilase family protein contains Pfam ... 26 7.9 At2g39180.1 68415.m04812 protein kinase family protein contains ... 26 7.9 At1g06920.1 68414.m00735 ovate family protein 58% similar to ova... 26 7.9 >At1g02816.1 68414.m00241 expressed protein contains Pfam profile PF04398: Protein of unknown function, DUF538 Length = 166 Score = 30.7 bits (66), Expect = 0.37 Identities = 17/35 (48%), Positives = 19/35 (54%) Frame = -2 Query: 392 FFFFLHCIYKVLIGAHRDDNAYTADHLETSDLIPI 288 FFFFL CI LI A DD+ TA L S P+ Sbjct: 9 FFFFLFCIPSPLIAAANDDDIPTAYTLLQSYNFPV 43 >At5g45650.1 68418.m05613 subtilase family protein contains Pfam domain, PF00082: Subtilase family; contains Pfam domain, PF02225: protease associated (PA) domain Length = 791 Score = 26.2 bits (55), Expect = 7.9 Identities = 16/41 (39%), Positives = 23/41 (56%) Frame = +1 Query: 268 PHVTGASIGMRSDVSKWSAV*ALSSLCAPMSTLYMQCKKKK 390 PHV GA +++ KWS+ S+L M+T +M KKK Sbjct: 582 PHVAGAIALLKAIHPKWSSAAIRSAL---MTTAWMTNDKKK 619 >At2g39180.1 68415.m04812 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 776 Score = 26.2 bits (55), Expect = 7.9 Identities = 14/31 (45%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -3 Query: 238 LCSPGFC*P-GHCSRGLCLWYICRLSALSGS 149 LCSPG C P G+C G W+ S L S Sbjct: 330 LCSPGMCSPRGNCGDG---WFAFNASILKES 357 >At1g06920.1 68414.m00735 ovate family protein 58% similar to ovate protein (GI:23429649) [Lycopersicon esculentum]; contains TIGRFAM TIGR01568 : uncharacterized plant-specific domain TIGR01568 Length = 315 Score = 26.2 bits (55), Expect = 7.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +2 Query: 8 DYYRTKKKHNKTEITKRNKTNKYLQETTLSADVPR 112 D RTKKKH KT ++ +++ L A PR Sbjct: 190 DACRTKKKHQKTLVSSGRRSSAKSPRIKLRARSPR 224 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,947,051 Number of Sequences: 28952 Number of extensions: 114056 Number of successful extensions: 249 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 249 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 565902384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -