BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30297 (378 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|... 32 0.034 SPAC23H4.06 |gln1||glutamate-ammonia ligase Gln1|Schizosaccharom... 26 2.3 SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyc... 25 3.9 SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificit... 25 5.2 SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr... 25 5.2 SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual 25 5.2 SPBC1773.16c |||transcription factor |Schizosaccharomyces pombe|... 24 6.9 SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyc... 24 9.1 SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizos... 24 9.1 SPAC14C4.06c |||poly|Schizosaccharomyces pombe|chr 1|||Manual 24 9.1 >SPBC28F2.12 |rpb1||DNA-directed RNA polymerase II large subunit|Schizosaccharomyces pombe|chr 2|||Manual Length = 1752 Score = 31.9 bits (69), Expect = 0.034 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 1/55 (1%) Frame = +1 Query: 58 SSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLP-IPDYIARAIEYIRTHP 219 S GYT+P + + Y + Y PS T+PA +P P Y + Y T P Sbjct: 1536 SPGYTSPFSSAMSPGYGLTSPSYSPSSPGYSTSPAYMPSSPSYSPTSPSYSPTSP 1590 Score = 26.6 bits (56), Expect = 1.3 Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +1 Query: 40 SIAVQGSSGYTAPDGTPIQITYTADANGYQPSG-AHLPTTPAPLPI-PDYIARAIEYIRT 213 S A+ G T+P +P Y+ Y PS ++ PT+P+ P P Y + Y T Sbjct: 1544 SSAMSPGYGLTSPSYSPSSPGYSTSP-AYMPSSPSYSPTSPSYSPTSPSYSPTSPSYSPT 1602 Query: 214 HP 219 P Sbjct: 1603 SP 1604 >SPAC23H4.06 |gln1||glutamate-ammonia ligase Gln1|Schizosaccharomyces pombe|chr 1|||Manual Length = 359 Score = 25.8 bits (54), Expect = 2.3 Identities = 9/21 (42%), Positives = 14/21 (66%), Gaps = 1/21 (4%) Frame = -3 Query: 97 SEWEYHQGQCSRLNLG-RRWM 38 S+WEY G C+ + +G + WM Sbjct: 201 SQWEYQVGPCAGIEMGDQLWM 221 >SPCC962.06c |bpb1|sf1|zinc finger protein Bpb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 587 Score = 25.0 bits (52), Expect = 3.9 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +1 Query: 46 AVQGSSGYTAPDGTPIQITYTADANGYQPSGAHLP 150 A+ G G TAP G P + +N P G +P Sbjct: 547 AMPGIPGATAPPGAPGSYNTSESSNLNAPPGVSMP 581 >SPAC6F12.17 |rna14||mRNA cleavage and polyadenylation specificity factor complex subunit Rna14|Schizosaccharomyces pombe|chr 1|||Manual Length = 733 Score = 24.6 bits (51), Expect = 5.2 Identities = 18/57 (31%), Positives = 22/57 (38%), Gaps = 5/57 (8%) Frame = +1 Query: 16 VNEGRED--ASIAVQGSSGYTAPDGT---PIQITYTADANGYQPSGAHLPTTPAPLP 171 V+ RED SIA S + T P + P + LPT P PLP Sbjct: 624 VHNNREDDEVSIASTSSKSNVEMEDTRLLPASLELANTQGASNPPTSALPTVPVPLP 680 >SPCC645.06c |rgf3|lad1|RhoGEF Rgf3|Schizosaccharomyces pombe|chr 3|||Manual Length = 1275 Score = 24.6 bits (51), Expect = 5.2 Identities = 13/32 (40%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = -2 Query: 365 FLTLIEVYFTYCETRHINDR-QCYGLRCFNNS 273 FLT Y C +R + QCY RC NS Sbjct: 397 FLTNGGCYSYICRSRSCPSKYQCYSCRCARNS 428 >SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual Length = 1611 Score = 24.6 bits (51), Expect = 5.2 Identities = 17/65 (26%), Positives = 27/65 (41%) Frame = +1 Query: 34 DASIAVQGSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRT 213 D + S G+ P P + + + Y+P ++L + PAP P P Y + Sbjct: 826 DEMASPSSSIGHPLPSPPPADFN-SLNVDFYEPH-SYLES-PAPEPQPSYEEESFNATVI 882 Query: 214 HPPKP 228 H P P Sbjct: 883 HAPTP 887 >SPBC1773.16c |||transcription factor |Schizosaccharomyces pombe|chr 2|||Manual Length = 595 Score = 24.2 bits (50), Expect = 6.9 Identities = 7/15 (46%), Positives = 10/15 (66%) Frame = -2 Query: 368 FFLTLIEVYFTYCET 324 FF +E+Y +YC T Sbjct: 444 FFTACVEIYLSYCNT 458 >SPAC2F7.11 |nrd1|msa2|RNA-binding protein Nrd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 529 Score = 23.8 bits (49), Expect = 9.1 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 49 VQGSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAP 165 VQ + YT+ G P T A A + +G ++ +P Sbjct: 56 VQSPTSYTSMHGLPFSTTQMAAAPAHPTTGYNVSRVTSP 94 >SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 1563 Score = 23.8 bits (49), Expect = 9.1 Identities = 11/40 (27%), Positives = 19/40 (47%) Frame = +1 Query: 58 SSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPIP 177 ++GYT + + + +T T A G + PTT +P Sbjct: 1109 TTGYTGTETSTVTVTPTGTATGTTTVVINTPTTTGSEVLP 1148 >SPAC14C4.06c |||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 307 Score = 23.8 bits (49), Expect = 9.1 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = +2 Query: 5 KECS*TRAVRMHPSPSKVQAATLP 76 KEC V+ HPSP+ V TLP Sbjct: 221 KECKAADCVKGHPSPATV--TTLP 242 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,412,189 Number of Sequences: 5004 Number of extensions: 26008 Number of successful extensions: 89 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 77 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 122233080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -