BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30297 (378 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles ... 28 0.099 AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein p... 24 1.6 AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha ... 23 4.9 L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. 22 6.5 >U50469-1|AAA93473.1| 160|Anopheles gambiae protein ( Anopheles gambiae putativecuticle protein mRNA, partial cds. ). Length = 160 Score = 28.3 bits (60), Expect = 0.099 Identities = 14/27 (51%), Positives = 16/27 (59%), Gaps = 1/27 (3%) Frame = +1 Query: 49 VQGSSGYTAPDGTPIQITYTADA-NGY 126 VQGS PDGT + YTAD NG+ Sbjct: 49 VQGSYSVVDPDGTKRTVDYTADPHNGF 75 >AB090815-1|BAC57905.1| 492|Anopheles gambiae gag-like protein protein. Length = 492 Score = 24.2 bits (50), Expect = 1.6 Identities = 12/34 (35%), Positives = 15/34 (44%) Frame = +1 Query: 67 YTAPDGTPIQITYTADANGYQPSGAHLPTTPAPL 168 +T DG + T NG Q + LPT A L Sbjct: 360 FTELDGVTFETKMTKSFNGMQTASVKLPTKLATL 393 >AF313909-1|AAL99382.1| 1024|Anopheles gambiae collagen IV alpha 1 chain protein. Length = 1024 Score = 22.6 bits (46), Expect = 4.9 Identities = 7/13 (53%), Positives = 9/13 (69%) Frame = +1 Query: 52 QGSSGYTAPDGTP 90 +G GYT P+G P Sbjct: 292 KGDKGYTGPEGPP 304 >L04753-1|AAA29357.1| 511|Anopheles gambiae alpha-amylase protein. Length = 511 Score = 22.2 bits (45), Expect = 6.5 Identities = 7/22 (31%), Positives = 13/22 (59%) Frame = -2 Query: 320 HINDRQCYGLRCFNNSRPYQLS 255 H N R YG+ + +PY+++ Sbjct: 317 HDNQRGDYGILTYKQPKPYKMA 338 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 372,597 Number of Sequences: 2352 Number of extensions: 7334 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 28646721 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -