Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdV30297
         (378 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle pr...    74   6e-16
DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor pro...    21   6.4  
AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.              20   8.4  
AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor typ...    20   8.4  

>EF531707-1|ABP57431.1|  138|Apis mellifera structural cuticle
           protein protein.
          Length = 138

 Score = 73.7 bits (173), Expect = 6e-16
 Identities = 33/69 (47%), Positives = 43/69 (62%)
 Frame = +1

Query: 34  DASIAVQGSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRT 213
           +  +  QGS  YTAPDG  + ITY AD NG+Q  G+H+PT P   PIP  I RA+E+   
Sbjct: 66  ETPVVSQGSDSYTAPDGQQVSITYVADENGFQVQGSHIPTAP---PIPPEIQRALEWNAA 122

Query: 214 HPPKPEVGQ 240
           HP + + GQ
Sbjct: 123 HPEEDDGGQ 131


>DQ151547-1|ABA39280.1|  405|Apis mellifera tyramine receptor
           protein.
          Length = 405

 Score = 20.6 bits (41), Expect = 6.4
 Identities = 5/9 (55%), Positives = 8/9 (88%)
 Frame = -1

Query: 228 WLGWVSSDV 202
           WLGW++S +
Sbjct: 346 WLGWINSAI 354


>AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein.
          Length = 1946

 Score = 20.2 bits (40), Expect = 8.4
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = -3

Query: 148 ADGHPKAGIRWRQ 110
           ADG PK  + W++
Sbjct: 702 ADGFPKPQVTWKK 714


>AF498306-5|AAM19330.1|  456|Apis mellifera dopamine receptor type
           D2 protein.
          Length = 456

 Score = 20.2 bits (40), Expect = 8.4
 Identities = 5/7 (71%), Positives = 7/7 (100%)
 Frame = -1

Query: 228 WLGWVSS 208
           WLGW++S
Sbjct: 377 WLGWINS 383


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 97,230
Number of Sequences: 438
Number of extensions: 1941
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9176370
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)