BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30297 (378 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 34 0.027 At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 ... 31 0.34 At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 ... 31 0.34 At3g61260.1 68416.m06856 DNA-binding family protein / remorin fa... 30 0.44 At3g25950.1 68416.m03234 hypothetical protein 30 0.44 At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10... 27 3.1 At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10... 27 3.1 At5g58160.1 68418.m07280 formin homology 2 domain-containing pro... 27 4.1 At3g51340.1 68416.m05620 aspartyl protease family protein contai... 27 4.1 At2g04780.2 68415.m00489 fasciclin-like arabinogalactan-protein ... 27 4.1 At2g04780.1 68415.m00488 fasciclin-like arabinogalactan-protein ... 27 4.1 At4g15730.1 68417.m02394 expressed protein 27 5.5 At2g26410.1 68415.m03169 calmodulin-binding family protein simil... 27 5.5 At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacu... 26 7.2 At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacu... 26 7.2 At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pf... 26 7.2 At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pf... 26 7.2 At1g74360.1 68414.m08615 leucine-rich repeat transmembrane prote... 26 7.2 At1g71800.1 68414.m08298 cleavage stimulation factor, putative s... 26 9.6 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 34.3 bits (75), Expect = 0.027 Identities = 22/58 (37%), Positives = 30/58 (51%), Gaps = 4/58 (6%) Frame = +1 Query: 58 SSGY--TAPDGTPIQITYTADANGYQP-SGAHLPTTPAPLPI-PDYIARAIEYIRTHP 219 S GY T+P +P TY+ + GY P S A+ PT+P+ P P Y + Y T P Sbjct: 1563 SPGYSPTSPGYSPTSPTYSPSSPGYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSP 1620 >At1g80490.2 68414.m09430 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.34 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 115 ANGYQPSGAHLPTTPAPLPIPDYIA 189 A G+ P GAH P P P P+P +A Sbjct: 227 AEGFPPLGAHGPFQPTPSPVPTPLA 251 >At1g80490.1 68414.m09429 WD-40 repeat family protein contains 9 WD-40 repeats domain (PF00400) (6 weak) Length = 1120 Score = 30.7 bits (66), Expect = 0.34 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +1 Query: 115 ANGYQPSGAHLPTTPAPLPIPDYIA 189 A G+ P GAH P P P P+P +A Sbjct: 227 AEGFPPLGAHGPFQPTPSPVPTPLA 251 >At3g61260.1 68416.m06856 DNA-binding family protein / remorin family protein similar to DNA-binding protein gi|601843 [Arabidopsis thaliana], remorin [Solanum tuberosum] GI:1881585; contains Pfam profiles PF03763: Remorin C-terminal region, PF03766: Remorin N-terminal region Length = 212 Score = 30.3 bits (65), Expect = 0.44 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +1 Query: 85 TPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKPE 231 +P ++T A A+ P+ A +P PAP P P + + + + P PE Sbjct: 13 SPAKVTTPAPADTPAPAPAEIPA-PAPAPTPADVTKDVAEEKIQNPPPE 60 >At3g25950.1 68416.m03234 hypothetical protein Length = 251 Score = 30.3 bits (65), Expect = 0.44 Identities = 21/50 (42%), Positives = 25/50 (50%) Frame = -2 Query: 275 SRPYQLSIT*IRWPTSGLGG*VLMYSMARAM*SGIGRGAGVVGRWAPEGW 126 S P+ L T +R GL G V++Y MA G G GVV RWA W Sbjct: 175 SPPFYLFYTVVR----GLAGPVVLYDMATFY--GSGAADGVVPRWAWLSW 218 >At1g15750.2 68414.m01890 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 3.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 115 ANGYQPSGAHLPTTPAPLPIPDYIA 189 A G+ P GAH P P P+P +A Sbjct: 227 AGGFPPLGAHGPFQPTASPVPTPLA 251 >At1g15750.1 68414.m01889 WD-40 repeat family protein contains 10 WD-40 repeats (PF00400) (1 weak) Length = 1131 Score = 27.5 bits (58), Expect = 3.1 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = +1 Query: 115 ANGYQPSGAHLPTTPAPLPIPDYIA 189 A G+ P GAH P P P+P +A Sbjct: 227 AGGFPPLGAHGPFQPTASPVPTPLA 251 >At5g58160.1 68418.m07280 formin homology 2 domain-containing protein / FH2 domain-containing protein low similarity to SP|Q05858 Formin (Limb deformity protein) {Gallus gallus}; contains Pfam profile PF02181: Formin Homology 2(FH2) Domain Length = 1307 Score = 27.1 bits (57), Expect = 4.1 Identities = 20/64 (31%), Positives = 25/64 (39%) Frame = +1 Query: 49 VQGSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKP 228 V SS P P T +NG + P PAP +P + A T PP P Sbjct: 722 VHTSSPPPPPPPPPPPAPPTPQSNGISAMKSSPPAPPAPPRLPTHSASPPP--PTAPPPP 779 Query: 229 EVGQ 240 +GQ Sbjct: 780 PLGQ 783 >At3g51340.1 68416.m05620 aspartyl protease family protein contains Eukaryotic and viral aspartyl proteases active site, PROSITE:PS00141 Length = 518 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/40 (30%), Positives = 19/40 (47%) Frame = +1 Query: 55 GSSGYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPI 174 G GYT + TP+ T+ A G +G + P +P+ Sbjct: 273 GDKGYTDQEETPLVSLETSTAYGVNVTGVSVGGVPVDVPL 312 >At2g04780.2 68415.m00489 fasciclin-like arabinogalactan-protein (FLA7) identical to gi_13377782_gb_AAK20860 Length = 254 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 97 ITYTADANGYQPSGAHLPTTPAPLPIPDYI 186 I +A A P LP TPAP P P+ + Sbjct: 16 IVCSASAKTASPPAPVLPPTPAPAPAPENV 45 >At2g04780.1 68415.m00488 fasciclin-like arabinogalactan-protein (FLA7) identical to gi_13377782_gb_AAK20860 Length = 254 Score = 27.1 bits (57), Expect = 4.1 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = +1 Query: 97 ITYTADANGYQPSGAHLPTTPAPLPIPDYI 186 I +A A P LP TPAP P P+ + Sbjct: 16 IVCSASAKTASPPAPVLPPTPAPAPAPENV 45 >At4g15730.1 68417.m02394 expressed protein Length = 1059 Score = 26.6 bits (56), Expect = 5.5 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 67 YTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPI 174 + +P T ++ D YQ SG+ L P +PI Sbjct: 102 FQSPPATSCKLVRNQDPQNYQTSGSLLAQAPGKVPI 137 >At2g26410.1 68415.m03169 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 516 Score = 26.6 bits (56), Expect = 5.5 Identities = 12/33 (36%), Positives = 17/33 (51%) Frame = +1 Query: 130 PSGAHLPTTPAPLPIPDYIARAIEYIRTHPPKP 228 PS H P P P P+PD+ + + + PP P Sbjct: 46 PSSVHRPYPPPP-PLPDFAPQPLLPPPSPPPPP 77 >At5g08450.2 68418.m00996 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +1 Query: 64 GYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPI 174 G T P + Y + +G P H P TP P + Sbjct: 12 GVTHPSSSSSVAKYPHEDSGSYPKSPHQPVTPPPAQV 48 >At5g08450.1 68418.m00995 expressed protein KED, Nicotiana tabacum, EMBL:AB009883 Length = 918 Score = 26.2 bits (55), Expect = 7.2 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +1 Query: 64 GYTAPDGTPIQITYTADANGYQPSGAHLPTTPAPLPI 174 G T P + Y + +G P H P TP P + Sbjct: 12 GVTHPSSSSSVAKYPHEDSGSYPKSPHQPVTPPPAQV 48 >At3g15880.2 68416.m02009 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1135 Score = 26.2 bits (55), Expect = 7.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 121 GYQPSGAHLPTTPAPLPIPDYIA 189 G+ P GAH P P P P+ +A Sbjct: 229 GFPPLGAHGPFQPTPAPLTTSLA 251 >At3g15880.1 68416.m02008 WD-40 repeat family protein contains Pfam profile: PF00400 WD domain, G-beta repeat (7 copies) Length = 1137 Score = 26.2 bits (55), Expect = 7.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = +1 Query: 121 GYQPSGAHLPTTPAPLPIPDYIA 189 G+ P GAH P P P P+ +A Sbjct: 229 GFPPLGAHGPFQPTPAPLTTSLA 251 >At1g74360.1 68414.m08615 leucine-rich repeat transmembrane protein kinase, putative similar to brassinosteroid insensitive 1 GB:AAC49810 (putative receptor protein kinase); contains Pfam profiles: PF00560 Leucine Rich Repeat (17 repeats), PF00069 Eukaryotic protein kinase domain Length = 1106 Score = 26.2 bits (55), Expect = 7.2 Identities = 14/39 (35%), Positives = 18/39 (46%), Gaps = 1/39 (2%) Frame = +1 Query: 13 LVNEGREDASIAVQGSSGYTAPD-GTPIQITYTADANGY 126 L+N G S + G+ GY AP+ G Q T D Y Sbjct: 965 LLNVGDSHVSTVIAGTIGYVAPEYGQTWQATTRGDVYSY 1003 >At1g71800.1 68414.m08298 cleavage stimulation factor, putative similar to cleavage stimulation factor 64 kilodalton subunit GB:AAD47839 GI:5713194 from [Drosophila melanogaster], SP|P33240 Cleavage stimulation factor, 64 kDa subunit {Homo sapiens}; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 461 Score = 25.8 bits (54), Expect = 9.6 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = +1 Query: 94 QITYTADANGYQPSGAHLPTTPA 162 QI D+N +QP G HL TT A Sbjct: 116 QIGGPVDSNMHQPVGLHLATTAA 138 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,488,779 Number of Sequences: 28952 Number of extensions: 147541 Number of successful extensions: 561 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 440 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 561 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 517767328 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -