BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30295 (592 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) simi... 128 3e-30 At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ... 126 1e-29 At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) 117 7e-27 At5g28190.1 68418.m03413 hypothetical protein 35 0.035 At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to hom... 31 0.43 At2g02640.1 68415.m00203 DC1 domain-containing protein contain... 31 0.57 At3g28360.1 68416.m03544 ABC transporter family protein similar ... 29 1.8 At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-b... 28 4.1 At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-g... 28 4.1 At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pf... 28 4.1 At1g05440.1 68414.m00552 expressed protein ; expression supporte... 28 4.1 At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-r... 28 5.4 At1g32190.1 68414.m03959 expressed protein 27 7.1 At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-g... 27 9.4 At3g28345.1 68416.m03541 ABC transporter family protein similar ... 27 9.4 At1g31870.1 68414.m03917 expressed protein 27 9.4 >At3g05590.1 68416.m00621 60S ribosomal protein L18 (RPL18B) similar to GB:P42791 Length = 187 Score = 128 bits (309), Expect = 3e-30 Identities = 59/90 (65%), Positives = 72/90 (80%) Frame = +1 Query: 247 GDSTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPTGKKTVLVQGQR 426 G T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRAP G+ TVL++G + Sbjct: 83 GTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK 142 Query: 427 NAREAVRHFGPAPGAPRSHTKPYVRTKDMK 516 N+REAV+HFGPAPG P SH+KPYVR K K Sbjct: 143 NSREAVKHFGPAPGVPHSHSKPYVRAKGRK 172 Score = 61.7 bits (143), Expect = 4e-10 Identities = 35/85 (41%), Positives = 49/85 (57%), Gaps = 1/85 (1%) Frame = +2 Query: 2 GID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPP 178 GID I +K +RT KS D+ TN+KFN ++L+RLFMS++N+ P Sbjct: 2 GIDLIAGGKSKKTKRTAPKSDDVYLKLTVKLYRFLVRRTNSKFNGVILKRLFMSKVNKAP 61 Query: 179 ISVSRLARHMKKPTREGLIAVVVGT 253 +S+SRL M +E IAV+VGT Sbjct: 62 LSLSRLVEFM--TGKEDKIAVLVGT 84 >At5g27850.1 68418.m03341 60S ribosomal protein L18 (RPL18C) 60S ribosomal protein L18, Arabidopsis thaliana, SWISSPROT:RL18_ARATH Length = 187 Score = 126 bits (304), Expect = 1e-29 Identities = 59/90 (65%), Positives = 72/90 (80%) Frame = +1 Query: 247 GDSTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPTGKKTVLVQGQR 426 G T+D+R+++IP M V AL TE+ARARI AGGE LTFDQLALRAP G+ TVL++G + Sbjct: 83 GTITDDLRVHEIPAMKVTALRFTERARARIEKAGGECLTFDQLALRAPLGQNTVLLRGPK 142 Query: 427 NAREAVRHFGPAPGAPRSHTKPYVRTKDMK 516 N+REAV+HFGPAPG P S+TKPYVR K K Sbjct: 143 NSREAVKHFGPAPGVPHSNTKPYVRHKGRK 172 Score = 57.2 bits (132), Expect = 8e-09 Identities = 32/85 (37%), Positives = 48/85 (56%), Gaps = 1/85 (1%) Frame = +2 Query: 2 GID-INHKHDRKVRRTEVKSQDIXXXXXXXXXXXXXXXTNAKFNQIVLRRLFMSRINRPP 178 GID I +K +RT KS D+ +N+ FN ++L+RLFMS++N+ P Sbjct: 2 GIDLIAGGKSKKTKRTAPKSDDVYLKLLVKLYRFLVRRSNSNFNAVILKRLFMSKVNKAP 61 Query: 179 ISVSRLARHMKKPTREGLIAVVVGT 253 +S+SRL M ++ IAV+VGT Sbjct: 62 LSLSRLVEFM--TGKDDKIAVLVGT 84 >At2g47570.1 68415.m05936 60S ribosomal protein L18 (RPL18A) Length = 135 Score = 117 bits (281), Expect = 7e-27 Identities = 57/91 (62%), Positives = 66/91 (72%), Gaps = 1/91 (1%) Frame = +1 Query: 247 GDSTNDVRLYKIPKMTVAALHVTEKARARILAAGGEILTFDQLALRAPT-GKKTVLVQGQ 423 G T+DVR+ +P +TV AL TE ARARI AGGE LTFDQLAL PT + TVL++G Sbjct: 30 GTVTDDVRIEDVPALTVTALRFTESARARIHKAGGECLTFDQLALPCPTWSENTVLLRGP 89 Query: 424 RNAREAVRHFGPAPGAPRSHTKPYVRTKDMK 516 +N REAV+HFGPAPG P SHTKPYVR K Sbjct: 90 KNTREAVKHFGPAPGVPHSHTKPYVRQTGKK 120 Score = 37.1 bits (82), Expect = 0.009 Identities = 17/33 (51%), Positives = 26/33 (78%) Frame = +2 Query: 155 MSRINRPPISVSRLARHMKKPTREGLIAVVVGT 253 MS++N+ P+S+SRL R+M ++G IAV+VGT Sbjct: 1 MSKVNKAPLSLSRLVRYM--DGKDGKIAVIVGT 31 >At5g28190.1 68418.m03413 hypothetical protein Length = 839 Score = 35.1 bits (77), Expect = 0.035 Identities = 31/117 (26%), Positives = 51/117 (43%), Gaps = 11/117 (9%) Frame = -2 Query: 519 LFHVLGANIGFSVRA-RCSWSRAKVTHCLTSISLTLYQ-------YCLLASRSTKSQLIK 364 L HVL +++GFS+R C + + +C + S LY+ Y LL + ++ Sbjct: 458 LMHVLRSSMGFSIRVMTCRRWKDSLLYCGNNNSGELYEEHTDGEKYHLLVVVGSFGGVVM 517 Query: 363 SKNFSSSSQNACTSFFGNMKSSHRHLRYLVQSHV---ICAVPTTTAIKPSRVGFFMW 202 S NM+SS H+ +++ HV + PTT+ + SR F W Sbjct: 518 IGGLSKVHILHHHQVLVNMESSMVHVIFVLLHHVFWMVLVFPTTSISRESRASFICW 574 >At1g18750.1 68414.m02338 MADS-box protein (AGL65) similar to homeodomain transcription factor (AGL30) GI:3461830 from [Arabidopsis thaliana]; contains Pfam domain PF00319: SRF-type transcription factor (DNA-binding and dimerisation domain); PMID: 12837945 Length = 389 Score = 31.5 bits (68), Expect = 0.43 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = -1 Query: 457 GQSDALPHEHFADLVPVLSSCQSEHEEPADQ 365 G S LPH +PV SSC E +P DQ Sbjct: 223 GDSSFLPHREMDGSIPVYSSCFFESTKPEDQ 253 >At2g02640.1 68415.m00203 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 627 Score = 31.1 bits (67), Expect = 0.57 Identities = 11/22 (50%), Positives = 15/22 (68%) Frame = +3 Query: 300 CSSCYRKSSCTHFGCWRRNSYF 365 CS+C RKS+ + C+ RN YF Sbjct: 423 CSACMRKSNGFGYSCYNRNCYF 444 >At3g28360.1 68416.m03544 ABC transporter family protein similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1158 Score = 29.5 bits (63), Expect = 1.8 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +1 Query: 352 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 444 E L FD L L+ P+GK LV G + + V Sbjct: 290 ETLIFDDLCLKIPSGKTVALVGGSGSGKSTV 320 >At3g28415.1 68416.m03551 P-glycoprotein, putative contains ATP-binding cassette; related to multi drug resistance proteins Length = 1221 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 364 FDQLALRAPTGKKTVLVQGQRNAREAV 444 FD L LR P+GK LV G + + V Sbjct: 356 FDDLCLRIPSGKSVALVGGSGSGKSTV 382 >At3g28390.1 68416.m03547 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1225 Score = 28.3 bits (60), Expect = 4.1 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = +1 Query: 364 FDQLALRAPTGKKTVLVQGQRNAREAV 444 FD L LR P+GK LV G + + V Sbjct: 365 FDDLCLRVPSGKTVALVGGSGSGKSTV 391 >At3g15470.1 68416.m01962 WD-40 repeat family protein contains Pfam PF00400: WD domain, G-beta repeat; similar to WD-repeat protein 5 (WD repeat protein BIG-3) (SP: Q9UGP9) [Homo sapiens] Length = 883 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/44 (36%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = +3 Query: 264 RETVQDTEDDGGCSSCY--RKSSCTHFGCWRRNSYF*SAGSSCS 389 R+ + +E GGC+SC KS T C R+ + S G+ CS Sbjct: 145 RDHGECSESVGGCASCIVRSKSDITTSQCGDRDRRYTSPGNPCS 188 >At1g05440.1 68414.m00552 expressed protein ; expression supported by MPSS Length = 393 Score = 28.3 bits (60), Expect = 4.1 Identities = 14/41 (34%), Positives = 24/41 (58%) Frame = -2 Query: 441 CLTSISLTLYQYCLLASRSTKSQLIKSKNFSSSSQNACTSF 319 CL S++ TL L +S+ ++L + NF S+ ++ TSF Sbjct: 71 CLDSLNATLDLMPLSVQKSSLTKLSSASNFKSTVESTPTSF 111 >At3g59820.1 68416.m06675 calcium-binding mitochondrial protein-related contains weak similarity to Calcium-binding mitochondrial protein Anon-60Da (Swiss-Prot:P91927) [Drosophila melanogaster] Length = 755 Score = 27.9 bits (59), Expect = 5.4 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +2 Query: 128 NQIVLRRLFMSRINRPPISVSRLARHMKKPTREGLI 235 +Q V + S INRPP+ + H R+GL+ Sbjct: 34 SQTVHSHAYHSGINRPPVETKPVTEHKSFTRRDGLL 69 >At1g32190.1 68414.m03959 expressed protein Length = 422 Score = 27.5 bits (58), Expect = 7.1 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 300 CSSCYRKSSCTHFGCWR 350 CSSC+ K C CW+ Sbjct: 359 CSSCFGKPKCPKCSCWK 375 >At3g28380.1 68416.m03546 P-glycoprotein, putative similar to P-glycoprotein homologue GI:2292907 from [Hordeum vulgare subsp. vulgare] Length = 1240 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 352 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 444 E FD L L+ P GK LV G + + V Sbjct: 373 ETTIFDDLCLKIPAGKTVALVGGSGSGKSTV 403 >At3g28345.1 68416.m03541 ABC transporter family protein similar to P-glycoprotein [Arabidopsis thaliana] GI:3849833; contains Pfam profiles PF00005: ABC transporter, PF00664: ABC transporter transmembrane region Length = 1240 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +1 Query: 352 EILTFDQLALRAPTGKKTVLVQGQRNAREAV 444 E FD LR P+GK LV G + + V Sbjct: 373 ETSIFDDFCLRVPSGKTVALVGGSGSGKSTV 403 >At1g31870.1 68414.m03917 expressed protein Length = 561 Score = 27.1 bits (57), Expect = 9.4 Identities = 12/27 (44%), Positives = 13/27 (48%) Frame = +1 Query: 433 REAVRHFGPAPGAPRSHTKPYVRTKDM 513 R RH P+P R HTKP DM Sbjct: 151 RRRKRHNSPSPEPNRKHTKPVSLDSDM 177 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,444,345 Number of Sequences: 28952 Number of extensions: 294297 Number of successful extensions: 846 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 804 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 844 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -