BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30294X (562 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schi... 27 1.9 SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosacc... 27 2.5 SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomy... 25 5.8 >SPBC1306.02 ||SPBC4.08|WD repeat protein, human WDR6 family|Schizosaccharomyces pombe|chr 2|||Manual Length = 984 Score = 27.1 bits (57), Expect = 1.9 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 285 LIYSRNDVHLLSIYRYDILCCLCISCVNSPIVF 187 ++ S+N VHLLS+ + ISC +P++F Sbjct: 116 VVTSKNQVHLLSLSKGSWEVTNTISCEKTPLLF 148 >SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosaccharomyces pombe|chr 1|||Manual Length = 434 Score = 26.6 bits (56), Expect = 2.5 Identities = 10/23 (43%), Positives = 19/23 (82%) Frame = -2 Query: 177 KLFA*IRELLLKINNIKDFVINK 109 +L A +RE +LK+N++K FV+++ Sbjct: 183 RLNALVREKILKVNSVKHFVLDE 205 >SPBC15C4.04c |||amino acid permease, unknown 10|Schizosaccharomyces pombe|chr 2|||Manual Length = 542 Score = 25.4 bits (53), Expect = 5.8 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = -1 Query: 508 LNRITVNYEDFYLVVLVFC 452 L+RIT Y F+L+VLV C Sbjct: 211 LDRITRFYATFHLIVLVVC 229 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,906,872 Number of Sequences: 5004 Number of extensions: 35688 Number of successful extensions: 89 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 86 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 236012634 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -