BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30294X (562 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0885 + 6966700-6966979,6967930-6968110,6968224-6968365,696... 31 0.63 06_03_0181 + 17618888-17619125,17621503-17621683,17621765-176219... 28 4.4 02_05_0973 + 33209385-33209456,33210517-33210721,33210810-332109... 28 5.9 >01_01_0885 + 6966700-6966979,6967930-6968110,6968224-6968365, 6968448-6968517,6968617-6968783 Length = 279 Score = 31.1 bits (67), Expect = 0.63 Identities = 11/42 (26%), Positives = 25/42 (59%) Frame = -3 Query: 284 LFIVEMMSICCLFIDMIYCVACVYHV*IPLLSSSYKNCLHKF 159 L+++ ++ CC F+ ++Y V V H +P+L Y++ + + Sbjct: 206 LWLLSVLGSCCNFLTLVYIVFVVLHT-VPILYEKYEDQIDSY 246 >06_03_0181 + 17618888-17619125,17621503-17621683,17621765-17621906, 17622002-17622071,17622162-17622307,17623382-17623948, 17624558-17624641,17624723-17624797,17625049-17625217, 17625395-17625586,17625662-17626053 Length = 751 Score = 28.3 bits (60), Expect = 4.4 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = -3 Query: 284 LFIVEMMSICCLFIDMIYCVACVYHV*IPLLSSSYKNCLHKF 159 L+++ + CC F+ +IY + H +P+L Y++ + F Sbjct: 192 LWVLSEVGSCCDFLTLIYVAVLMLHT-VPILYDKYQDKVDHF 232 >02_05_0973 + 33209385-33209456,33210517-33210721,33210810-33210975, 33211268-33211490,33211928-33212004,33212090-33212183, 33212202-33212271,33212350-33212447,33212565-33212692, 33212772-33212900,33213013-33213421,33213984-33214105, 33214224-33214313,33215092-33215304,33215453-33215584, 33216258-33216333,33216403-33216420 Length = 773 Score = 27.9 bits (59), Expect = 5.9 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = -2 Query: 420 LILLNLSKKSHKNHKVF*YQFHKYLAFIN*KKTPVNYLKFIY 295 +I+LNL KK + + +F + + IN N+L+F++ Sbjct: 328 IIILNLIKKRERRESILRREFDRAIRIINKNIPEENHLRFLH 369 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,997,477 Number of Sequences: 37544 Number of extensions: 154293 Number of successful extensions: 269 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 221 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 269 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1281410928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -