BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30294X (562 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 prot... 25 0.52 DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid p... 22 3.7 AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatas... 22 3.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.9 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 21 8.5 >AF274024-1|AAF90150.1| 232|Apis mellifera tetraspanin F139 protein. Length = 232 Score = 25.0 bits (52), Expect = 0.52 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 265 IISTINKFNQVN-KFQIIYWSFFLINKCKIFMKLILKNL 378 ++ + F ++ K+Q I+ +FL ++ K F+ I KNL Sbjct: 105 VVKNDDNFRNISEKYQEIFNGYFLNSESKDFIDFIQKNL 143 >DQ058012-1|AAY57281.1| 373|Apis mellifera venom allergen acid phosphatase protein. Length = 373 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 158 RIYANNFYMRKTIGEFTHDIHRQHNISYL 244 R Y ++R+ G+F DI+ + ++S L Sbjct: 48 REYQLGQFLRERYGDFLGDIYTEESVSAL 76 >AY939855-1|AAX33235.1| 388|Apis mellifera venom acid phosphatase precursor protein. Length = 388 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +2 Query: 158 RIYANNFYMRKTIGEFTHDIHRQHNISYL 244 R Y ++R+ G+F DI+ + ++S L Sbjct: 63 REYQLGQFLRERYGDFLGDIYTEESVSAL 91 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 4.9 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 243 RYDILCCLCISCVNSPI 193 R+ CCLC+ +N+ I Sbjct: 350 RHSDSCCLCLDSMNAVI 366 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 21.0 bits (42), Expect = 8.5 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = +1 Query: 304 FQIIYWSFFLI 336 F I+YWSF I Sbjct: 459 FNILYWSFIWI 469 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 126,022 Number of Sequences: 438 Number of extensions: 2432 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16195212 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -