BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30293X (585 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase ... 27 1.5 SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 27 2.7 SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyce... 27 2.7 SPBC15D4.15 |pho2||4-nitrophenylphosphatase |Schizosaccharomyces... 26 4.7 SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2... 25 8.1 SPCC1827.03c |||acetyl-CoA ligase |Schizosaccharomyces pombe|chr... 25 8.1 SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schi... 25 8.1 SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|ch... 25 8.1 SPAC57A10.04 |mug10||sequence orphan|Schizosaccharomyces pombe|c... 25 8.1 >SPBC1198.01 |||glutathione-dependent formaldehyde dehydrogenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 423 Score = 27.5 bits (58), Expect = 1.5 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +3 Query: 381 SMRIISRSGDQVSPAEIGDNLVLQVDV 461 S I++ GD+V+ EIGD +V+ D+ Sbjct: 99 SCGIVAEKGDEVNNLEIGDRVVIAFDL 125 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 26.6 bits (56), Expect = 2.7 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +3 Query: 354 ANTGPPPTCSMRIISRSGDQVSPAEIGDNLVLQVDVQPSSIYGGFGRSCVA 506 +NT PT S+ I+S +PA+ N + QV SIY F +A Sbjct: 280 SNTINIPTDSLSIVSNPSQ--TPAKFDSNRISQVPNSDYSIYSNFNNFPIA 328 >SPAC823.16c |mug179||WD repeat protein Mug179|Schizosaccharomyces pombe|chr 1|||Manual Length = 335 Score = 26.6 bits (56), Expect = 2.7 Identities = 10/30 (33%), Positives = 17/30 (56%) Frame = -3 Query: 337 VNMDTLNARVTFCSPVLYMHLMWNAFVVML 248 + D + R+ + SPVL + WN VV++ Sbjct: 74 IKRDIVLCRIFYPSPVLSVRFTWNRLVVLI 103 >SPBC15D4.15 |pho2||4-nitrophenylphosphatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 298 Score = 25.8 bits (54), Expect = 4.7 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 4/46 (8%) Frame = +1 Query: 79 LYVKSYSKDDRCRKVVEMPKDEESFVFFTVHFGD----CGLVHVNG 204 +Y +YS +KV+++P D++ FV D G+ H+ G Sbjct: 83 IYPSAYSSATYVKKVLKLPADKKVFVLGEAGIEDELDRVGVAHIGG 128 >SPBC15D4.05 |||conserved protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 411 Score = 25.0 bits (52), Expect = 8.1 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%) Frame = +1 Query: 112 CRKVVEMPKDEESFVFFTVHFGDCGLVHVNGLAS---FVLVMQTHLKL 246 C+ + + KDE F + DC +++ L S +V QT LK+ Sbjct: 191 CKNIDNILKDESDIGFIQISHADCLILNKTDLISSEALSVVRQTILKI 238 >SPCC1827.03c |||acetyl-CoA ligase |Schizosaccharomyces pombe|chr 3|||Manual Length = 512 Score = 25.0 bits (52), Expect = 8.1 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +3 Query: 390 IISRSGDQVSPAEIGDNLVLQVDV 461 +++R G+++SPAEI L+ DV Sbjct: 407 LVNRGGEKISPAEIDAVLMQHPDV 430 >SPBC21C3.01c |vps13a|vps1301, SPBC31F10.18c|chorein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 3071 Score = 25.0 bits (52), Expect = 8.1 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +1 Query: 70 NGLLYVKSYSKDDRCRKVVEMPKDEESFVFFTVHFGDCGLVHVNGLASFVLVMQ 231 + LL VK+ D ++++ KD+E V G+C VH + S VL++Q Sbjct: 2039 SALLEVKNLLPIDLNIRIID--KDQEGVWMSNVGIGECAYVHSINI-SHVLLLQ 2089 >SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 25.0 bits (52), Expect = 8.1 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +1 Query: 91 SYSKDDRCRKVVEMPKDEESFVFFTVHF 174 SYSK R V ++P++ + FVF + + Sbjct: 304 SYSKTKLGRAVAKLPQNLQPFVFMIIQY 331 >SPAC57A10.04 |mug10||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 338 Score = 25.0 bits (52), Expect = 8.1 Identities = 12/26 (46%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = -2 Query: 326 HIECKSYVL-FTSFVYAFDVECFCGD 252 HI+ K V+ TSF+Y F+ FC D Sbjct: 227 HIKFKGSVIPATSFIYDFNACVFCDD 252 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,396,340 Number of Sequences: 5004 Number of extensions: 47489 Number of successful extensions: 136 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 136 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 252150250 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -