BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30293X (585 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0250 - 2622738-2623328,2626525-2627169,2627701-2627754 30 1.6 07_01_0067 + 490614-490796,491194-491358 29 3.6 >10_01_0250 - 2622738-2623328,2626525-2627169,2627701-2627754 Length = 429 Score = 29.9 bits (64), Expect = 1.6 Identities = 24/98 (24%), Positives = 41/98 (41%), Gaps = 2/98 (2%) Frame = +1 Query: 1 PTPDIQVECLADGVRVRLKIKDFNGLLYVKSYSKDDRCRKVVEMPKDEESFVFFTVHFGD 180 P + + + DG+ + F +L + S+ +R + E P D S + F D Sbjct: 258 PNKEKTIHWMTDGIIYSVTYAKFAAILGFPARSRTNRVKIHDEKPMDTNS-LHFLYQDVD 316 Query: 181 CGLVHVNGLASFVLVMQTHLKLVTSPQKHSTSN--AYT 288 L + GL F + L+ +P++ SN AYT Sbjct: 317 YELGTIKGLLPFYAYLNKLLRKTLNPKEGDASNVLAYT 354 >07_01_0067 + 490614-490796,491194-491358 Length = 115 Score = 28.7 bits (61), Expect = 3.6 Identities = 24/96 (25%), Positives = 40/96 (41%), Gaps = 9/96 (9%) Frame = +1 Query: 28 LADGVRVRLKIKDFNGLLYVKSYSKDDRCRKVVEMPKDEESFVFFTVHFGD-------CG 186 L D V + + + ++ S S+D K+ +PKD S V + + CG Sbjct: 12 LLDNFAVGMSLDEIGTIVINNSISRDRPSLKIRGVPKDVRSCDVERVRYKEQLSTRVGCG 71 Query: 187 LVH--VNGLASFVLVMQTHLKLVTSPQKHSTSNAYT 288 VH V + +V+ +L T HST + +T Sbjct: 72 RVHRIVENVLDKCIVVAPNLPTKTDNLSHSTGHGWT 107 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,679,286 Number of Sequences: 37544 Number of extensions: 318390 Number of successful extensions: 756 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 745 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 756 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -