BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30293X (585 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) 29 2.1 SB_4294| Best HMM Match : DUF622 (HMM E-Value=7) 29 2.8 SB_47039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.4 SB_32741| Best HMM Match : Filament (HMM E-Value=0.39) 27 8.5 >SB_15021| Best HMM Match : Zona_pellucida (HMM E-Value=0) Length = 751 Score = 29.5 bits (63), Expect = 2.1 Identities = 20/61 (32%), Positives = 26/61 (42%) Frame = +1 Query: 13 IQVECLADGVRVRLKIKDFNGLLYVKSYSKDDRCRKVVEMPKDEESFVFFTVHFGDCGLV 192 I+V C + VRL ++ F L D C+ VV E+ VFF V CG Sbjct: 412 IKVICSKHDMEVRLYMEYFERLSIDSLRLSDRACKPVVT----NETLVFFKVPLDGCGTA 467 Query: 193 H 195 H Sbjct: 468 H 468 >SB_4294| Best HMM Match : DUF622 (HMM E-Value=7) Length = 360 Score = 29.1 bits (62), Expect = 2.8 Identities = 30/101 (29%), Positives = 41/101 (40%), Gaps = 5/101 (4%) Frame = +3 Query: 186 PCSCQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGEQNVTLAFN---VSMLTTAGTI- 353 P + Q L+ SN T +TT I C ++ LA + ++ G + Sbjct: 180 PVAVQSLAMSTQSNLVQGSTRMVTT----IPCSTNNTHNHINLACSSIPIAPAVAVGPVH 235 Query: 354 -ANTGPPPTCSMRIISRSGDQVSPAEIGDNLVLQVDVQPSS 473 A G P C SRS D SP D+L LQV Q S+ Sbjct: 236 VAPQGQEPQCEEIGESRSSDDSSPGACADSL-LQVPRQASN 275 >SB_47039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 384 Score = 27.9 bits (59), Expect = 6.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 154 VFFTVHFGDCGLVHVNGLASF 216 V+ VHF CG++ VNG A F Sbjct: 354 VYGNVHFSTCGMMPVNGNAHF 374 >SB_32741| Best HMM Match : Filament (HMM E-Value=0.39) Length = 1814 Score = 27.5 bits (58), Expect = 8.5 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 1/46 (2%) Frame = +1 Query: 109 RCRKVVEMPKDEESFVFFTVHF-GDCGLVHVNGLASFVLVMQTHLK 243 RC+K + +E+ +F +F GD L+ + G A+ V+Q+HLK Sbjct: 1418 RCQKSLNEFLEEKRSLFPRFYFIGDDDLLEILGQATNPTVIQSHLK 1463 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,082,548 Number of Sequences: 59808 Number of extensions: 362836 Number of successful extensions: 980 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 843 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 979 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1410146228 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -