BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30293X (585 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g47530.1 68416.m05169 pentatricopeptide (PPR) repeat-containi... 29 2.3 At5g19160.1 68418.m02281 expressed protein predicted proteins, A... 29 3.0 At4g25315.1 68417.m03641 Expressed protein 28 5.3 At2g29640.1 68415.m03601 josephin family protein contains Pfam d... 27 9.2 >At3g47530.1 68416.m05169 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 591 Score = 29.1 bits (62), Expect = 2.3 Identities = 21/64 (32%), Positives = 28/64 (43%), Gaps = 4/64 (6%) Frame = +3 Query: 120 SCRDA*RRRKFCFLHC-TFRR---LRPCSCQWLSKLRSSNANSSETGNITTKAFHIKCIY 287 SCR +R HC T R L C+ RS NSS N + +F +KC Sbjct: 65 SCRVFSQRLNPTLSHCNTMIRAFSLSQTPCEGFRLFRSLRRNSSLPANPLSSSFALKCCI 124 Query: 288 KTGE 299 K+G+ Sbjct: 125 KSGD 128 >At5g19160.1 68418.m02281 expressed protein predicted proteins, Arabidopsis thaliana and Oryza sativa; expression supported by MPSS Length = 464 Score = 28.7 bits (61), Expect = 3.0 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +3 Query: 375 TCSMRIISRSGDQVSPAEIGDNLVLQVDVQPSSIY 479 TC M + G + PAE D++ L DV SS+Y Sbjct: 345 TCHMETLPDFGASLVPAETWDHIKLLQDVLSSSLY 379 >At4g25315.1 68417.m03641 Expressed protein Length = 127 Score = 27.9 bits (59), Expect = 5.3 Identities = 9/35 (25%), Positives = 19/35 (54%) Frame = +3 Query: 195 CQWLSKLRSSNANSSETGNITTKAFHIKCIYKTGE 299 C W+S+ + +N +TGN + ++ Y+ G+ Sbjct: 27 CYWMSRWSNITSNGDDTGNDLAPFYQMQQYYRVGK 61 >At2g29640.1 68415.m03601 josephin family protein contains Pfam domain PF02099: Josephin; similar to Josephin-like protein (Swiss-Prot:O82391) [Arabidopsis thaliana] Length = 360 Score = 27.1 bits (57), Expect = 9.2 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 1/121 (0%) Frame = +3 Query: 138 RRRKFCFLHCTFRRLRPCSCQWLSKLRSSNANSSETGNITTKAF-HIKCIYKTGEQNVTL 314 +R +FC LHC L + + +S A ET + + + + + K +T Sbjct: 13 QRLQFCLLHC-LNNLFQDKDAFTKESLNSIAEKLETNDPNKETWTPLSFVLKPHHNTITG 71 Query: 315 AFNVSMLTTAGTIANTGPPPTCSMRIISRSGDQVSPAEIGDNLVLQVDVQPSSIYGGFGR 494 ++V+++ TA + G + I S + A+ +VL V P YGG R Sbjct: 72 NYDVNVMITA--LEGKGKSVVWHDKRIGASSIDLDDADTLMGIVLNV---PVKRYGGLWR 126 Query: 495 S 497 S Sbjct: 127 S 127 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,598,651 Number of Sequences: 28952 Number of extensions: 254243 Number of successful extensions: 687 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 687 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1151426952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -