BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30292X (576 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia nu... 60 3e-08 UniRef50_A0BX75 Cluster: Chromosome undetermined scaffold_134, w... 34 2.8 UniRef50_Q8YXJ6 Cluster: L-aspartate oxidase; n=15; Cyanobacteri... 33 6.4 UniRef50_A5C1W6 Cluster: Putative uncharacterized protein; n=1; ... 32 8.4 >UniRef50_A4KWG0 Cluster: Reverse transcriptase; n=3; Ostrinia nubilalis|Rep: Reverse transcriptase - Ostrinia nubilalis (European corn borer) Length = 497 Score = 60.5 bits (140), Expect = 3e-08 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -3 Query: 454 SLGRPHPTSWIDDLLRFAGIRCMQAAQDRSLWRGLEEVYVQQ*TS 320 S+GRP PT W DDL++ AG MQAAQDRSLW+ L E +VQQ TS Sbjct: 452 SVGRP-PTRWTDDLVKVAGSTWMQAAQDRSLWKSLGEAFVQQWTS 495 >UniRef50_A0BX75 Cluster: Chromosome undetermined scaffold_134, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_134, whole genome shotgun sequence - Paramecium tetraurelia Length = 562 Score = 33.9 bits (74), Expect = 2.8 Identities = 21/59 (35%), Positives = 31/59 (52%), Gaps = 1/59 (1%) Frame = -3 Query: 520 CRTDVAEAETFYSSNRVLEDVGSLGRPHPTSWID-DLLRFAGIRCMQAAQDRSLWRGLE 347 C+ D+A A T SN LE GS + W++ +LLR AG++ + D + GLE Sbjct: 411 CKNDLATALTKQKSNLPLECAGS--SENDFYWLNAELLRMAGVQIPDSVSDELNYNGLE 467 >UniRef50_Q8YXJ6 Cluster: L-aspartate oxidase; n=15; Cyanobacteria|Rep: L-aspartate oxidase - Anabaena sp. (strain PCC 7120) Length = 578 Score = 32.7 bits (71), Expect = 6.4 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -3 Query: 496 ETFYSSNRVLEDVGSLGRPHPTSWIDDLLRFAGIRCMQAAQDRSLW 359 E +S NRVL + GR T+ D +LR I+ +Q A SLW Sbjct: 136 EAAHSRNRVLHAADTTGREVTTTLTDQVLRRPNIQVIQQALALSLW 181 >UniRef50_A5C1W6 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 725 Score = 32.3 bits (70), Expect = 8.4 Identities = 18/49 (36%), Positives = 21/49 (42%) Frame = +1 Query: 286 PNTIYLLSLKPQTFTAGHRPPPSLAITSGPALLACSGSPRTLIGRRSSL 432 P IY+ + PQ+FT G P L P C G P TL S L Sbjct: 155 PTVIYVWGIPPQSFTFGASPHCHLCSGHSPFSSLCLGHPPTLESSSSLL 203 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 457,290,464 Number of Sequences: 1657284 Number of extensions: 8567946 Number of successful extensions: 23492 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 22736 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 23481 length of database: 575,637,011 effective HSP length: 96 effective length of database: 416,537,747 effective search space used: 39571085965 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -