BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30292X (576 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 27 2.6 SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schi... 27 2.6 SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pom... 27 2.6 SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase s... 26 3.4 SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing] |Schizosacch... 25 6.0 SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1||... 25 6.0 SPAC3C7.05c |mug191||alpha-1,6-mannanase |Schizosaccharomyces po... 25 6.0 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 26.6 bits (56), Expect = 2.6 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = -1 Query: 300 IDSVRALFMLMLFCITDKFKKYIVLYVN 217 I+ + LF +LFC+ +KYI++YV+ Sbjct: 596 INPLVLLFASVLFCVNYLTQKYILMYVS 623 >SPCC14G10.02 ||SPCC18B5.13|ribosome biogenesis protein Urb1|Schizosaccharomyces pombe|chr 3|||Manual Length = 1568 Score = 26.6 bits (56), Expect = 2.6 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +2 Query: 461 VFQYAVATIERFSLSDIGSTISIFLTSNLSLVYLF 565 VF+ A+ T+E F L+D + L+S ++ V LF Sbjct: 938 VFEPALHTVENFDLTDCADEQILLLSSFVNFVPLF 972 >SPCC1682.08c |||RNA-binding protein Mcp2|Schizosaccharomyces pombe|chr 3|||Manual Length = 703 Score = 26.6 bits (56), Expect = 2.6 Identities = 28/108 (25%), Positives = 52/108 (48%), Gaps = 4/108 (3%) Frame = +2 Query: 242 LNLSVMQNNININNALTLSIFYL*SHRRSLLDIDLLQASP*RAVLRCLHAADPR---EP* 412 +NLS NN++ N + TL + L S R S + A+ +++ ++ ++P E Sbjct: 280 VNLSASTNNLSTNTSGTLKPYSLSSSRSSSYSKGVNSAASLQSIWETMNNSNPSVIPEST 339 Query: 413 *VVDPACRVRS-TQATYVFQYAVATIERFSLSDIGSTISIFLTSNLSL 553 +PA R R ++ V+ + V I++ +S+ SIFL L + Sbjct: 340 SSREPAARYRKISERNAVYDWNV-IIDKIIVSN-DQQSSIFLQQKLKI 385 >SPBPJ4664.01 |dps1|SPBPJ694.01|decaprenyl diphosphate synthase subunit Dps1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 378 Score = 26.2 bits (55), Expect = 3.4 Identities = 19/59 (32%), Positives = 26/59 (44%), Gaps = 8/59 (13%) Frame = +1 Query: 313 KPQTFTAGHRPPPSLAITSGPALLACSGSPRTLIG--------RRSSL*GEVYPSYLRL 465 K T G + PSL + A C G R+++G RS G++ PS LRL Sbjct: 64 KYYTIAQGKQMRPSLVLLMSKATSLCHGIDRSVVGDKYIDDDDLRSFSTGQILPSQLRL 122 >SPBPB2B2.05 |||GMP synthase [glutamine-hydrolyzing] |Schizosaccharomyces pombe|chr 2|||Manual Length = 237 Score = 25.4 bits (53), Expect = 6.0 Identities = 18/41 (43%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Frame = -2 Query: 350 GGGLCPAVNVCGFKD-RR*IVLGHYLC*CCFA*QINLKNIL 231 GG L V+ CGF+D R HYL A LKNIL Sbjct: 95 GGSLYQNVSSCGFRDIHRPSKPRHYLAHKVMAKPGKLKNIL 135 >SPAC1006.06 |rgf2||RhoGEF Rgf2|Schizosaccharomyces pombe|chr 1|||Manual Length = 1158 Score = 25.4 bits (53), Expect = 6.0 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 535 KKNRYCRTDVAEAETFYSSNRVLEDVGSLGRPH 437 KKN + R + + S R +++ SLGRPH Sbjct: 96 KKNNFYRRSSSTDDFGISHARSRKEIQSLGRPH 128 >SPAC3C7.05c |mug191||alpha-1,6-mannanase |Schizosaccharomyces pombe|chr 1|||Manual Length = 442 Score = 25.4 bits (53), Expect = 6.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 454 YLRLPVRGCYYRTF 495 YLR+P G YYR F Sbjct: 338 YLRIPKEGLYYRNF 351 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,935,551 Number of Sequences: 5004 Number of extensions: 36566 Number of successful extensions: 79 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 75 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 79 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 246098644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -