BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30292X (576 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant r... 26 1.0 AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 23 7.1 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 23 9.4 >AY062432-1|AAL47188.1| 391|Anopheles gambiae putative odorant receptor Or5 protein. Length = 391 Score = 25.8 bits (54), Expect = 1.0 Identities = 17/49 (34%), Positives = 24/49 (48%), Gaps = 3/49 (6%) Frame = -1 Query: 456 VAWVDLTLQAGSTTY*GS--RGSAACKQRRTARYGEAW-RRSMSSSERL 319 V ++ LT++ Y GS A+C A YG W RRS+S +L Sbjct: 299 VLFILLTVETYGFCYFGSDLTSEASCYSLTRAAYGSLWYRRSVSIQRKL 347 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 23.0 bits (47), Expect = 7.1 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 224 YKTIYFLNLSVMQNNININNALT 292 Y +I +NL V QN IN+ A+T Sbjct: 345 YPSISQINLKVKQNAINVILAVT 367 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 22.6 bits (46), Expect = 9.4 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 448 PSYLRLPVRGCYYRTFQPQRHRF 516 P YL LPV G Y +P+ +R+ Sbjct: 414 PEYLNLPVEGPY----KPEHYRY 432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 489,818 Number of Sequences: 2352 Number of extensions: 8228 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -