BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30291 (471 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0300 + 23932947-23933196,23934022-23934123,23934249-239343... 100 5e-22 01_06_1103 - 34543915-34543955,34544069-34544137,34544294-345443... 99 2e-21 01_01_1199 - 9657169-9657254,9657369-9657395,9657485-9657553,965... 97 6e-21 03_05_0830 + 28034179-28035492 29 1.9 11_01_0682 - 5575297-5575308,5575391-5575516,5575779-5575885,557... 28 3.3 06_01_1127 + 9294079-9294193,9294300-9294369,9294611-9294716,929... 27 5.8 08_01_0906 + 8933230-8933797,8933894-8934543,8937956-8938615,893... 27 7.6 07_03_1085 - 23851852-23853165 27 7.6 >05_05_0300 + 23932947-23933196,23934022-23934123,23934249-23934317, 23934406-23934446 Length = 153 Score = 100 bits (240), Expect = 5e-22 Identities = 42/58 (72%), Positives = 47/58 (81%) Frame = +2 Query: 242 CSSARKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 415 C RKSEIEYYA+L K VHH+ GNN++LGTACGKYYRVC L+I DPGDSDII T P Sbjct: 93 CPPLRKSEIEYYAMLGKVSVHHFHGNNVDLGTACGKYYRVCCLSIIDPGDSDIINTTP 150 Score = 74.1 bits (174), Expect = 5e-14 Identities = 34/54 (62%), Positives = 41/54 (75%) Frame = +3 Query: 93 VAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 V A QKK+ ++IN++L LVMKSGKY LGYK LKTLR K KL+I+A N PPL Sbjct: 43 VVAMMQKKSTDNINNKLQLVMKSGKYTLGYKTVLKTLRNSKGKLIILANNCPPL 96 >01_06_1103 - 34543915-34543955,34544069-34544137,34544294-34544395, 34545603-34545708,34545998-34546079,34546850-34547142 Length = 230 Score = 98.7 bits (235), Expect = 2e-21 Identities = 40/60 (66%), Positives = 49/60 (81%) Frame = +2 Query: 242 CSSARKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLPEA 421 C RKSEIEYYA+L K V+H++GNN++LGTACGKYYRVC L++ DPGDSDI LPE+ Sbjct: 170 CPPLRKSEIEYYAMLGKVSVYHFNGNNVDLGTACGKYYRVCCLSVVDPGDSDITKQLPES 229 Score = 70.9 bits (166), Expect = 5e-13 Identities = 33/48 (68%), Positives = 36/48 (75%) Frame = +3 Query: 111 KKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 KK E IN++L LVMKSGKY LGYK LKTLR K KLVI+A N PPL Sbjct: 126 KKNAEGINNKLQLVMKSGKYTLGYKTVLKTLRNSKGKLVIVANNCPPL 173 >01_01_1199 - 9657169-9657254,9657369-9657395,9657485-9657553, 9657922-9658023,9659895-9660000,9660145-9660165 Length = 136 Score = 97.1 bits (231), Expect = 6e-21 Identities = 41/56 (73%), Positives = 47/56 (83%) Frame = +2 Query: 242 CSSARKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITT 409 C RKSEIEYYA+LAK VHH+ GNN++LGTACGKY+RVC L+I DPGDSDII T Sbjct: 52 CPPLRKSEIEYYAMLAKVTVHHFHGNNVDLGTACGKYFRVCCLSIIDPGDSDIIKT 107 Score = 80.6 bits (190), Expect = 6e-16 Identities = 38/55 (69%), Positives = 45/55 (81%) Frame = +3 Query: 90 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 MVAAKK KK+ ++IN++L LVMKSGKY LGYK L+TLR KAKLVII+ N PPL Sbjct: 1 MVAAKKTKKSTDNINNKLQLVMKSGKYTLGYKTVLRTLRNSKAKLVIISNNCPPL 55 >03_05_0830 + 28034179-28035492 Length = 437 Score = 29.1 bits (62), Expect = 1.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 159 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 242 +GKY G TLKTL G + +I+ +N Sbjct: 299 TGKYVFGVDDTLKTLEMGAVETLIVWEN 326 >11_01_0682 - 5575297-5575308,5575391-5575516,5575779-5575885, 5575911-5576013,5576122-5576187,5576378-5576461, 5577448-5577522,5577615-5577668,5577752-5577895, 5578632-5578685,5578877-5578981,5579076-5579173, 5579660-5579729,5580444-5580566,5580647-5580727, 5580996-5581476,5581684-5581816,5582550-5582598, 5582704-5582892,5583642-5583703,5583762-5585316 Length = 1256 Score = 28.3 bits (60), Expect = 3.3 Identities = 13/24 (54%), Positives = 16/24 (66%) Frame = +3 Query: 189 TLKTLRQGKAKLVIIAKNAPPLGN 260 TLK LR G K+V + KN+ P GN Sbjct: 524 TLKMLRVGILKVVSLTKNSVPTGN 547 >06_01_1127 + 9294079-9294193,9294300-9294369,9294611-9294716, 9295665-9295805,9296377-9296475 Length = 176 Score = 27.5 bits (58), Expect = 5.8 Identities = 16/41 (39%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +3 Query: 141 LALVMKSGKY-CL--GYKQTLKTLRQGKAKLVIIAKNAPPL 254 L LV ++ + CL G K+ +K++R+G+ L IIA N P+ Sbjct: 33 LKLVRRASEAKCLKRGVKEVVKSIRRGQKGLCIIAGNISPI 73 >08_01_0906 + 8933230-8933797,8933894-8934543,8937956-8938615, 8939751-8939817,8940421-8940724,8942993-8942996, 8944539-8946449 Length = 1387 Score = 27.1 bits (57), Expect = 7.6 Identities = 18/52 (34%), Positives = 27/52 (51%) Frame = +3 Query: 93 VAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAP 248 V++ Q +ES+ + L V SG Y LG+KQ L+T +G I+ P Sbjct: 1333 VSSSLQFSGLESMET-LKEVWLSGSYELGFKQQLETELKGNENEPILELEKP 1383 >07_03_1085 - 23851852-23853165 Length = 437 Score = 27.1 bits (57), Expect = 7.6 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = +3 Query: 159 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 242 +GKY G TLK L G + +I+ +N Sbjct: 299 TGKYVFGVDDTLKALEMGAVETLIVWEN 326 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,715,645 Number of Sequences: 37544 Number of extensions: 219465 Number of successful extensions: 508 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 500 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 508 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -