BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30291 (471 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) 105 2e-23 SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) 28 3.4 SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) 27 5.9 >SB_40337| Best HMM Match : Ribosomal_L7Ae (HMM E-Value=7.3e-31) Length = 108 Score = 105 bits (252), Expect = 2e-23 Identities = 49/85 (57%), Positives = 61/85 (71%) Frame = +2 Query: 161 GKILLRIQANFENSSTRQSKAGYHR*KCSSARKSEIEYYALLAKTGVHHYSGNNIELGTA 340 GK L +++ + ++K RKSEIEYYA+LAKTGVHHY+GNNIELGTA Sbjct: 15 GKFTLGLKSTLKTLRQGKAKLVIIANNTPQLRKSEIEYYAMLAKTGVHHYTGNNIELGTA 74 Query: 341 CGKYYRVCTLAITDPGDSDIITTLP 415 CGKY+RV L+ITDPGDSDII ++P Sbjct: 75 CGKYFRVSVLSITDPGDSDIIRSMP 99 Score = 74.5 bits (175), Expect = 4e-14 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +3 Query: 120 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 +ESINSRLALVMKSGK+ LG K TLKTLRQGKAKLVIIA N P L Sbjct: 1 MESINSRLALVMKSGKFTLGLKSTLKTLRQGKAKLVIIANNTPQL 45 >SB_21661| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 1202 Score = 28.3 bits (60), Expect = 3.4 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +3 Query: 363 AHSPSQTLVTRTLSPLC 413 AHSP+ TL+T TL+P C Sbjct: 152 AHSPATTLITVTLTPNC 168 >SB_29957| Best HMM Match : Pro_racemase (HMM E-Value=0) Length = 576 Score = 27.5 bits (58), Expect = 5.9 Identities = 16/33 (48%), Positives = 22/33 (66%), Gaps = 3/33 (9%) Frame = +2 Query: 308 YSGNNIEL--GTA-CGKYYRVCTLAITDPGDSD 397 ++GN I+L G A CGKYY +C A ++ GD D Sbjct: 101 HTGNPIQLPYGLAWCGKYYNMCDNA-SNSGDVD 132 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,505,728 Number of Sequences: 59808 Number of extensions: 255085 Number of successful extensions: 712 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 662 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 711 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 982083920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -