BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30291 (471 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) simi... 99 8e-22 At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) simi... 99 1e-21 At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) simi... 98 2e-21 At3g02300.1 68416.m00212 regulator of chromosome condensation (R... 28 2.8 At3g26618.1 68416.m03325 eukaryotic release factor 1 family prot... 28 3.7 At1g12920.1 68414.m01500 eukaryotic release factor 1 family prot... 27 4.8 At4g18820.1 68417.m02778 expressed protein 27 6.4 >At1g77940.1 68414.m09083 60S ribosomal protein L30 (RPL30B) similar to ribosomal protein L30 GI:388034 from [Homo sapiens] Length = 112 Score = 99 bits (238), Expect = 8e-22 Identities = 41/58 (70%), Positives = 50/58 (86%) Frame = +2 Query: 242 CSSARKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 415 C R+SEIEYYA+LAK GVHHY+GNN++LGTACGKY+RV L+I DPGDSDII ++P Sbjct: 52 CPPLRRSEIEYYAMLAKVGVHHYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSIP 109 Score = 77.4 bits (182), Expect = 5e-15 Identities = 37/55 (67%), Positives = 42/55 (76%) Frame = +3 Query: 90 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 MV KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPL Sbjct: 1 MVTEKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRGSKGKLILISTNCPPL 55 >At3g18740.1 68416.m02379 60S ribosomal protein L30 (RPL30C) similar to 60S RIBOSOMAL PROTEIN L30 GB:O49884 from [Lupinus luteus] Length = 112 Score = 99.1 bits (236), Expect = 1e-21 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = +2 Query: 242 CSSARKSEIEYYALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 415 C R+SEIEYYA+LAK GVH Y+GNN++LGTACGKY+RV L+I DPGDSDII TLP Sbjct: 52 CPPLRRSEIEYYAMLAKVGVHRYNGNNVDLGTACGKYFRVSCLSIVDPGDSDIIKTLP 109 Score = 80.2 bits (189), Expect = 6e-16 Identities = 38/55 (69%), Positives = 43/55 (78%) Frame = +3 Query: 90 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 MVA KK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPL Sbjct: 1 MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPL 55 >At1g36240.1 68414.m04505 60S ribosomal protein L30 (RPL30A) similar to GI:6984132 from [Euphorbia esula] Length = 112 Score = 98.3 bits (234), Expect = 2e-21 Identities = 49/106 (46%), Positives = 67/106 (63%) Frame = +2 Query: 98 SKETEKDHRVN*LPPCFGDEIGKILLRIQANFENSSTRQSKAGYHR*KCSSARKSEIEYY 277 +K+T+K H + GK L ++ ++ + + K C R+SEIEYY Sbjct: 4 AKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYY 63 Query: 278 ALLAKTGVHHYSGNNIELGTACGKYYRVCTLAITDPGDSDIITTLP 415 A+LAK GVHHY+ NN++LGTACGKY+RV L+I DPGDSDII +LP Sbjct: 64 AMLAKVGVHHYNRNNVDLGTACGKYFRVSCLSIVDPGDSDIIKSLP 109 Score = 82.2 bits (194), Expect = 2e-16 Identities = 39/55 (70%), Positives = 44/55 (80%) Frame = +3 Query: 90 MVAAKKQKKTIESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPPL 254 MVAAKK KK+ E INSRLALVMKSGKY LGYK LK+LR K KL++I+ N PPL Sbjct: 1 MVAAKKTKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPL 55 >At3g02300.1 68416.m00212 regulator of chromosome condensation (RCC1) family protein weak similarity to UVB-resistance protein UVR8 [Arabidopsis thaliana] GI:5478530; contains Pfam profile PF00415: Regulator of chromosome condensation (RCC1) Length = 471 Score = 28.3 bits (60), Expect = 2.8 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = +3 Query: 120 IESINSRLALVMKSGKYCLGYKQTLKTLRQGKAKLVIIAKNAPP 251 I + +++ KS Y GY Q+ +T R + KL+ I K PP Sbjct: 7 IGEVAPSVSIPTKSAIYVWGYNQSGQTGRNEQEKLLRIPKQLPP 50 >At3g26618.1 68416.m03325 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 435 Score = 27.9 bits (59), Expect = 3.7 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 159 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 242 +GKY G + TLK L G + +I+ +N Sbjct: 298 TGKYVFGVEDTLKALEMGAVETLIVWEN 325 >At1g12920.1 68414.m01500 eukaryotic release factor 1 family protein / eRF1 family protein contains Pfam profiles: PF03463 eRF1 domain 1, PF03464 eRF1 domain 2, PF03465 eRF1 domain 3 Length = 434 Score = 27.5 bits (58), Expect = 4.8 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 159 SGKYCLGYKQTLKTLRQGKAKLVIIAKN 242 +GKY G + TLK L G + +I+ +N Sbjct: 297 TGKYVFGVEDTLKALEMGAIETLIVWEN 324 >At4g18820.1 68417.m02778 expressed protein Length = 1111 Score = 27.1 bits (57), Expect = 6.4 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -3 Query: 391 VTRVCDGECAHSVVFSACCS*FNVVPAVVVNTC 293 +++V D VVF CS +V+P V+++ C Sbjct: 565 LSKVVDRAAPRHVVFILVCSSLDVLPHVIISRC 597 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,360,458 Number of Sequences: 28952 Number of extensions: 177946 Number of successful extensions: 446 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 439 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 446 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 801831960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -