BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30290 (425 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 26 0.49 AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. 23 3.4 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 26.2 bits (55), Expect = 0.49 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = -1 Query: 104 KLNDDFGTGPDEDLSFPSLFS 42 +L DDF TGPD + + P++FS Sbjct: 609 ELRDDFPTGPDPNFN-PNIFS 628 >AJ535207-1|CAD59407.1| 1036|Anopheles gambiae SMC5 protein protein. Length = 1036 Score = 23.4 bits (48), Expect = 3.4 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +3 Query: 3 MNVLSDALKSIHNAEKRGKRQVLIRPCSKV 92 +N+L+ + A+KR + Q L+R C K+ Sbjct: 602 LNLLNRSTDHALLAQKRQEHQRLVRECDKI 631 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 388,504 Number of Sequences: 2352 Number of extensions: 7005 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 34867302 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -