BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30289 (713 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23596| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 5e-12 SB_38755| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) 31 1.2 SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) 30 2.1 SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) 30 2.1 SB_21575| Best HMM Match : Trypsin (HMM E-Value=0) 29 2.8 >SB_23596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 830 Score = 68.5 bits (160), Expect = 5e-12 Identities = 29/51 (56%), Positives = 41/51 (80%) Frame = +3 Query: 30 QNLIKDGLVLVEQVRDSRLATLMAEYRAAQEHAKSSRLNLWRHGDITEDDA 182 ++L+ DG VLVE+ ++ RL +M EYR AQ+ A+++RLNLWR+GD TEDDA Sbjct: 661 KSLVADGFVLVEKRKEKRLQKMMEEYRKAQDTARTTRLNLWRYGDFTEDDA 711 >SB_38755| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 471 Score = 33.1 bits (72), Expect = 0.23 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = -3 Query: 456 HHRNVLRHNTRIVISNNKLLINKQL 382 HH+N++ +N I+I+NN ++IN + Sbjct: 387 HHQNIIINNNNIIINNNNIIINNNI 411 Score = 27.9 bits (59), Expect = 8.6 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = -3 Query: 456 HHRNVLRHNTRIVISNNKLLIN 391 HH+ H+ I+I+NN ++IN Sbjct: 380 HHQQQQHHHQNIIINNNNIIIN 401 >SB_11317| Best HMM Match : Trypsin (HMM E-Value=3e-08) Length = 153 Score = 30.7 bits (66), Expect = 1.2 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +1 Query: 76 TADWRH*WPSIAPLRSTPRARDSTCGGTVTSPRTMQWNSGCVASCTPPAL 225 TA ++ WP A LRS + CGGT+ PR + S C+ TP +L Sbjct: 28 TAAPKNAWPWQAQLRSA--SGFPFCGGTLVHPRFVVTASHCIDKKTPSSL 75 >SB_36311| Best HMM Match : Pox_A32 (HMM E-Value=0.16) Length = 869 Score = 29.9 bits (64), Expect = 2.1 Identities = 13/41 (31%), Positives = 24/41 (58%) Frame = -2 Query: 262 GTVRMCVGDVVASTPGAYS*RRTPNSTASSSVMSPCRHKLS 140 G++ +C G ++A GA R N+ ++S + CRH+L+ Sbjct: 538 GSLSLCCGRLMALAVGALHVARHVNTAGTASADTRCRHELA 578 >SB_5854| Best HMM Match : Pkinase_Tyr (HMM E-Value=4.3e-17) Length = 1850 Score = 29.9 bits (64), Expect = 2.1 Identities = 20/52 (38%), Positives = 25/52 (48%) Frame = -3 Query: 222 RRGRTASDAPRIPLHRPR*CHRAATS*VASSWRAPERRDTRPSMSPVGCHEP 67 R G TA+ P +P RP C R A S+R P+ D S SP H+P Sbjct: 1601 RPGMTATPPPPLPTRRPSSCSRPAPQ---LSYRPPDVTDVLCSNSP-RHHQP 1648 >SB_21575| Best HMM Match : Trypsin (HMM E-Value=0) Length = 696 Score = 29.5 bits (63), Expect = 2.8 Identities = 18/46 (39%), Positives = 22/46 (47%) Frame = +1 Query: 91 H*WPSIAPLRSTPRARDSTCGGTVTSPRTMQWNSGCVASCTPPALT 228 H WP LR P R +CGGT+ S R + S CV P+ T Sbjct: 39 HSWPWQISLR--PYGRYHSCGGTLISDRWVVTASHCVHKNPRPSYT 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,040,626 Number of Sequences: 59808 Number of extensions: 434535 Number of successful extensions: 1112 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1016 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1109 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1889780269 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -