BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30289 (713 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. 24 5.4 Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase pr... 23 9.5 AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 23 9.5 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 23 9.5 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 23 9.5 >AF444780-1|AAL37901.1| 1152|Anopheles gambiae Toll protein. Length = 1152 Score = 23.8 bits (49), Expect = 5.4 Identities = 12/20 (60%), Positives = 13/20 (65%), Gaps = 1/20 (5%) Frame = +1 Query: 199 VASCTPPAL-TPPHRPRTSA 255 V TPPAL TPP P +SA Sbjct: 1080 VTPATPPALTTPPTEPISSA 1099 >Z49815-1|CAA89969.1| 237|Anopheles gambiae serine proteinase protein. Length = 237 Score = 23.0 bits (47), Expect = 9.5 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 148 CGGTVTSPRTMQWNSGCVASCTPPAL 225 CGG++ + R + + CV S TP L Sbjct: 26 CGGSLINDRYIVTAAHCVLSFTPQQL 51 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 23.0 bits (47), Expect = 9.5 Identities = 20/61 (32%), Positives = 26/61 (42%), Gaps = 2/61 (3%) Frame = -1 Query: 248 VRGRCGGVNAGGVQLATHPEFHCIVLGDVTV--PPQVESRALGVLLSGAILGHQCRQSAV 75 +R R G + G V L+ HP+ L D+TV P AL V A GH + Sbjct: 833 LRRRGGTLKPGDVLLSNHPQAGGSHLPDLTVITPVFAPGEALPVFFV-ASRGHHADIGGI 891 Query: 74 T 72 T Sbjct: 892 T 892 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 32 EPYQRWARVSGAGS*QPTGDIDGRVSR 112 EP +RW R G QP GRV + Sbjct: 113 EPSRRWTRSGATGRRQPHPYRAGRVGQ 139 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 23.0 bits (47), Expect = 9.5 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = +2 Query: 32 EPYQRWARVSGAGS*QPTGDIDGRVSR 112 EP +RW R G QP GRV + Sbjct: 113 EPSRRWTRSGATGRRQPHPYRAGRVGQ 139 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 713,196 Number of Sequences: 2352 Number of extensions: 14013 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 73177125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -