BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30289 (713 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g69280.1 68414.m07943 expressed protein 33 0.14 At5g07350.1 68418.m00839 tudor domain-containing protein / nucle... 32 0.33 At5g61780.1 68418.m07753 tudor domain-containing protein / nucle... 31 0.76 At5g32621.1 68418.m03884 expressed protein contains Pfam profile... 29 3.1 At5g03500.1 68418.m00306 transcriptional co-activator-related lo... 28 5.3 At3g06080.2 68416.m00695 expressed protein identical to unknown ... 28 7.1 At1g55430.1 68414.m06340 DC1 domain-containing protein contains ... 27 9.3 At1g20900.1 68414.m02617 DNA-binding protein-related contains Pf... 27 9.3 >At1g69280.1 68414.m07943 expressed protein Length = 400 Score = 33.5 bits (73), Expect = 0.14 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -1 Query: 299 RGRCCRHLQWCRWHSADVRGRCG 231 R +CC WCRW S D CG Sbjct: 329 RLKCCPCFSWCRWPSCDYNSSCG 351 >At5g07350.1 68418.m00839 tudor domain-containing protein / nuclease family protein contains Pfam domains PF00567: Tudor domain and PF00565: Staphylococcal nuclease homologue Length = 991 Score = 32.3 bits (70), Expect = 0.33 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 117 QEHAKSSRLNLWRHGDITEDD 179 QE A+ SR+ +W++GDI DD Sbjct: 957 QEEARKSRIGIWQYGDIESDD 977 >At5g61780.1 68418.m07753 tudor domain-containing protein / nuclease family protein contains Pfam domains PF00567: Tudor domain and PF00565: Staphylococcal nuclease homologue Length = 985 Score = 31.1 bits (67), Expect = 0.76 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +3 Query: 117 QEHAKSSRLNLWRHGDITEDDAVEFGVRR 203 Q+ A+ SR +W +GDI DD VR+ Sbjct: 953 QDEARKSRTGIWEYGDIQSDDEDNVPVRK 981 >At5g32621.1 68418.m03884 expressed protein contains Pfam profile PF04827: Protein of unknown function (DUF635) Length = 625 Score = 29.1 bits (62), Expect = 3.1 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = -3 Query: 321 HSI--W*RMAWTMLSTSTVVQVAQCGCAWAMWWRQRRGRTASDAPRIPLH 178 HSI W + A T + S ++++ C + +W R+R R S+ R P H Sbjct: 538 HSILLWLKSASTSKNLSLIIKLIFQACVYLIW-RERNSRIHSNNSRTPSH 586 >At5g03500.1 68418.m00306 transcriptional co-activator-related low similarity to transcriptional co-activator CRSP33 [Homo sapiens] GI:4220890 Length = 443 Score = 28.3 bits (60), Expect = 5.3 Identities = 13/28 (46%), Positives = 14/28 (50%) Frame = +1 Query: 409 IANYDTCVVPEDITMVSSEHGSGRGAAT 492 + YDTCV DI M EH S G T Sbjct: 310 VTGYDTCVPKIDIQMALCEHFSSCGEVT 337 >At3g06080.2 68416.m00695 expressed protein identical to unknown protein GB:AAF30301 from [Arabidopsis thaliana] Length = 469 Score = 27.9 bits (59), Expect = 7.1 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 123 APERRDTRPSMSPVGCHEPAPLTR 52 A +R+D PS+ +G H PAPL R Sbjct: 399 AAQRKDGHPSLYYLGPHGPAPLHR 422 >At1g55430.1 68414.m06340 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 657 Score = 27.5 bits (58), Expect = 9.3 Identities = 11/47 (23%), Positives = 21/47 (44%) Frame = -3 Query: 552 YVCKFKKYVFMNYARMLACKCCGTPSAAVFTAHHRNVLRHNTRIVIS 412 Y + ++Y L CKCC +P ++ +H + + N + S Sbjct: 163 YAVAYNDGASLSYGNHLKCKCCASPLEKLY--YHCSTCKFNLNLTCS 207 >At1g20900.1 68414.m02617 DNA-binding protein-related contains Pfam domain PF03479: Domain of unknown function (DUF296), found in AT-hook motifs Pfam:PF02178 Length = 311 Score = 27.5 bits (58), Expect = 9.3 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = -1 Query: 242 GRCGGVNAGGVQLATHPEFHCIVLGDVTVPPQVESRA--LGVLLSG 111 G GGV+ GG + H F + L +PP A L + L+G Sbjct: 162 GNGGGVSGGGGVVTLHGRFEILSLTGTVLPPPAPPGAGGLSIFLAG 207 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,199,250 Number of Sequences: 28952 Number of extensions: 281210 Number of successful extensions: 732 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 714 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 730 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1545769616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -