BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30287 (358 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q5UQS8 Cluster: TFII-like transcription factor; n=1; Ac... 35 0.48 UniRef50_A5BY14 Cluster: Putative uncharacterized protein; n=1; ... 31 5.9 UniRef50_A5BG34 Cluster: Putative uncharacterized protein; n=2; ... 31 7.7 UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba his... 31 7.7 UniRef50_Q99176 Cluster: Protein SRN2; n=3; Saccharomyces cerevi... 31 7.7 >UniRef50_Q5UQS8 Cluster: TFII-like transcription factor; n=1; Acanthamoeba polyphaga mimivirus|Rep: TFII-like transcription factor - Mimivirus Length = 173 Score = 34.7 bits (76), Expect = 0.48 Identities = 26/67 (38%), Positives = 32/67 (47%), Gaps = 5/67 (7%) Frame = +3 Query: 171 INQLDSEFYE*LKCNQI--GIYCFLKYYCYSKNKNGKVNHHLW*DCYTQI---LNEINGI 335 I QL F + C I GIY F K YC S N ++ ++ DC I L + N Sbjct: 18 IEQLLEFFPKKKNCKDIEKGIYDFTKQYCKSDNSYLRLAQAIYIDCAKNIMFNLKDENNH 77 Query: 336 TIKKKKK 356 TIKK KK Sbjct: 78 TIKKIKK 84 >UniRef50_A5BY14 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1348 Score = 31.1 bits (67), Expect = 5.9 Identities = 20/58 (34%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 25 CYEYLIICLRKCMVYERAY*ETWQLCHFLVDK--KFGKVFLKESL*EYKKQSISLIVN 192 C L L++C+ E+ W+ CHF+V+K G V ++ + E K I LIVN Sbjct: 820 CLSNLETILQRCI--EKNLVLNWEKCHFMVEKGIVLGHVVSRKDI-EVDKAKIELIVN 874 >UniRef50_A5BG34 Cluster: Putative uncharacterized protein; n=2; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1654 Score = 30.7 bits (66), Expect = 7.7 Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%) Frame = +1 Query: 25 CYEYLIICLRKCMVYERAY*ETWQLCHFLVDK--KFGKVFLKESL*EYKKQSISLIVN 192 C L L++C+ E+ W+ CHF+V+K G V ++ + E K I +IVN Sbjct: 608 CLSNLETILQRCI--EKNLVLNWEKCHFMVEKGIVLGHVISRKGI-EVDKAKIEIIVN 662 >UniRef50_P54401 Cluster: Tubulin gamma chain; n=3; Entamoeba histolytica|Rep: Tubulin gamma chain - Entamoeba histolytica Length = 451 Score = 30.7 bits (66), Expect = 7.7 Identities = 18/48 (37%), Positives = 28/48 (58%), Gaps = 3/48 (6%) Frame = -3 Query: 167 FLYSHRDSLRKTFPNFLSTKK*QSCQVSQYALS*TI---HFRKQIIKY 33 +L + RD+LRK FP F +K+ C + +YA + +I H+ I KY Sbjct: 394 YLQTDRDNLRK-FPEFEESKEIVKCVIEEYAKAESIEYSHYSYPIHKY 440 >UniRef50_Q99176 Cluster: Protein SRN2; n=3; Saccharomyces cerevisiae|Rep: Protein SRN2 - Saccharomyces cerevisiae (Baker's yeast) Length = 213 Score = 30.7 bits (66), Expect = 7.7 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 49 LRKCMVYERAY*ETWQLCHFLVDKKFGKVFLKESL*EYKKQ 171 L C + E Y +WQ H KK+G + LK+ L + K+ Sbjct: 120 LENCRILESKYVASWQDYHSEFSKKYGDIALKKKLEQNTKK 160 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 287,373,365 Number of Sequences: 1657284 Number of extensions: 4823731 Number of successful extensions: 9781 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9781 length of database: 575,637,011 effective HSP length: 90 effective length of database: 426,481,451 effective search space used: 11941480628 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -