BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30287 (358 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A11.08 |pcu4|cul4, Cul-4|cullin 4|Schizosaccharomyces pombe... 25 3.5 SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|c... 24 6.1 SPAC212.03 |||hypothetical protein|Schizosaccharomyces pombe|chr... 24 6.1 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 24 6.1 SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharom... 24 8.0 SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|... 24 8.0 >SPAC3A11.08 |pcu4|cul4, Cul-4|cullin 4|Schizosaccharomyces pombe|chr 1|||Manual Length = 734 Score = 25.0 bits (52), Expect = 3.5 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -3 Query: 170 CFLYSHRDSLRKTFPNFLSTKK*QSCQVSQYAL 72 C + SH D+L K F+ + SC++ YAL Sbjct: 265 CLITSHLDTLTKGISQFIEKRDAHSCKL-LYAL 296 >SPBCPT2R1.03 |||hypothetical protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 129 Score = 24.2 bits (50), Expect = 6.1 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 210 CNQIGIYCFLKYYCYSKNKNGKVNHHLW*DCYTQILNEING 332 C G + + + Y Y GK +++ DCY+ + +NG Sbjct: 90 CQSTGKW-YSQLYDYQNTFIGKQEYNILFDCYSYLKYNLNG 129 >SPAC212.03 |||hypothetical protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 129 Score = 24.2 bits (50), Expect = 6.1 Identities = 11/41 (26%), Positives = 20/41 (48%) Frame = +3 Query: 210 CNQIGIYCFLKYYCYSKNKNGKVNHHLW*DCYTQILNEING 332 C G + + + Y Y GK +++ DCY+ + +NG Sbjct: 90 CQSTGKW-YSQLYDYQNTFIGKQEYNILFDCYSYLKYNLNG 129 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 24.2 bits (50), Expect = 6.1 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 197 IKFTIKLIDCFLYSHRDSLRKTFPNFL 117 I+ T+ ++CF +D+L P F+ Sbjct: 2104 IEVTLPCVECFFKYKKDALHTLLPGFM 2130 >SPBC6B1.05c |||ubiquitin-like conjugating enzyme|Schizosaccharomyces pombe|chr 2|||Manual Length = 649 Score = 23.8 bits (49), Expect = 8.0 Identities = 9/14 (64%), Positives = 12/14 (85%) Frame = -3 Query: 200 FIKFTIKLIDCFLY 159 FIKF +K+I+ FLY Sbjct: 237 FIKFKLKVINLFLY 250 >SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|Schizosaccharomyces pombe|chr 1|||Manual Length = 1199 Score = 23.8 bits (49), Expect = 8.0 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 100 CHFLVDKKFGKVFLKESL*EYKKQSISL 183 C VDK K+ LK+ + YKK S +L Sbjct: 62 CFSSVDKNTEKLILKQQVLAYKKLSQNL 89 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,312,006 Number of Sequences: 5004 Number of extensions: 23772 Number of successful extensions: 57 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 2,362,478 effective HSP length: 65 effective length of database: 2,037,218 effective search space used: 107972554 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -