BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30287 (358 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905,581... 29 1.1 11_04_0026 - 12446179-12446399,12446604-12447303 27 3.3 01_05_0211 + 19341747-19341829,19342347-19342542,19342572-19343498 27 3.3 11_04_0182 - 14597325-14597881,14598082-14598243,14598416-14598950 27 4.3 10_07_0004 - 11722867-11723532,11724778-11724825 27 4.3 07_01_1139 - 10684647-10685837,10685877-10686251,10686351-106865... 27 4.3 07_02_0032 - 12037507-12038435,12038475-12038586,12038912-120391... 27 5.7 06_03_0017 - 15465831-15466043,15466091-15466249,15466664-154669... 27 5.7 02_03_0077 + 14874273-14874571,14875304-14876150,14876878-148771... 27 5.7 02_03_0049 + 14421408-14421942,14421988-14422842,14423847-144241... 27 5.7 01_05_0238 - 19711579-19712145,19712188-19712370 27 5.7 12_01_0543 - 4271380-4272218,4272258-4272873 26 7.6 11_02_0151 + 8837444-8837876,8838173-8839434,8839517-8839885,883... 26 7.6 08_02_0030 + 11380149-11380721,11380800-11381073,11381281-11382449 26 7.6 >06_01_0778 + 5816588-5816885,5817554-5817615,5818764-5818905, 5819969-5820064,5820147-5820266,5820401-5820663, 5821507-5821617 Length = 363 Score = 29.1 bits (62), Expect = 1.1 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = +3 Query: 204 LKCNQIGIYCFLKYYCYSKNKNGKVNHHLW 293 LKCN I +YC +Y CYS +K + W Sbjct: 296 LKCN-IWVYCPSEYGCYSPDKYEHKHQECW 324 >11_04_0026 - 12446179-12446399,12446604-12447303 Length = 306 Score = 27.5 bits (58), Expect = 3.3 Identities = 11/27 (40%), Positives = 16/27 (59%) Frame = +1 Query: 232 VFLNITAIPKTKMAKLTITCGKIAIHK 312 VF N +P T++ KLT C + +HK Sbjct: 260 VFNNKRPLPTTEVVKLTEQCSNLILHK 286 >01_05_0211 + 19341747-19341829,19342347-19342542,19342572-19343498 Length = 401 Score = 27.5 bits (58), Expect = 3.3 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHKF 315 N +P T++ KLT C + +HKF Sbjct: 280 NKRPLPTTEVVKLTEQCSNVILHKF 304 >11_04_0182 - 14597325-14597881,14598082-14598243,14598416-14598950 Length = 417 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P TK+ KLT C + +HK Sbjct: 262 NKRPLPTTKLVKLTEECSNVILHK 285 >10_07_0004 - 11722867-11723532,11724778-11724825 Length = 237 Score = 27.1 bits (57), Expect = 4.3 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P T++ KLT+ C + +HK Sbjct: 83 NKRPLPTTEVVKLTLQCSNVILHK 106 >07_01_1139 - 10684647-10685837,10685877-10686251,10686351-10686534, 10686699-10686895 Length = 648 Score = 27.1 bits (57), Expect = 4.3 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P T++ KLT C K+ +HK Sbjct: 394 NKRPLPTTEVVKLTKQCSKVILHK 417 >07_02_0032 - 12037507-12038435,12038475-12038586,12038912-12039199, 12039395-12039622 Length = 518 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P TK+ KLT C + +HK Sbjct: 294 NERPLPTTKVVKLTEQCSNVILHK 317 >06_03_0017 - 15465831-15466043,15466091-15466249,15466664-15466968, 15467083-15467324,15467818-15467825,15467954-15468418, 15468465-15468763,15468968-15469204,15469297-15469519 Length = 716 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P T++AKLT C I +HK Sbjct: 183 NKRPLPTTEVAKLTEHCSNIILHK 206 >02_03_0077 + 14874273-14874571,14875304-14876150,14876878-14877147, 14877313-14878065 Length = 722 Score = 26.6 bits (56), Expect = 5.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P T+M KLT C + +HK Sbjct: 143 NKRPLPTTEMVKLTEQCSNVILHK 166 >02_03_0049 + 14421408-14421942,14421988-14422842,14423847-14424151, 14424469-14424984 Length = 736 Score = 26.6 bits (56), Expect = 5.7 Identities = 11/24 (45%), Positives = 14/24 (58%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHK 312 N +P TK+ KLT C I +HK Sbjct: 208 NKRPLPTTKVVKLTEHCSNIILHK 231 >01_05_0238 - 19711579-19712145,19712188-19712370 Length = 249 Score = 26.6 bits (56), Expect = 5.7 Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 160 YKKQSISL---IVNFMXXXXVIK*VSIVFLNITAIPKTKMAKLTITCGKIAIHK 312 +KK SI + +++ M + + + N +P T++ KLT C K +HK Sbjct: 57 FKKPSIHIHVMLLDTMQVSTYARYLKDILNNKRPLPTTEVVKLTEECSKAILHK 110 >12_01_0543 - 4271380-4272218,4272258-4272873 Length = 484 Score = 26.2 bits (55), Expect = 7.6 Identities = 11/44 (25%), Positives = 23/44 (52%) Frame = +1 Query: 181 LIVNFMXXXXVIK*VSIVFLNITAIPKTKMAKLTITCGKIAIHK 312 L+++ M + + + N ++P T++ KLT C + +HK Sbjct: 270 LLLDAMQVPTYARYLKDILNNKRSLPTTEVVKLTKQCSNVILHK 313 >11_02_0151 + 8837444-8837876,8838173-8839434,8839517-8839885, 8839963-8840223,8840230-8840442,8840602-8840967, 8841402-8841667,8842087-8842197,8842288-8842317, 8842444-8842465 Length = 1110 Score = 26.2 bits (55), Expect = 7.6 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +2 Query: 47 VCESVWFMKEHTEKPGN 97 VC S++F EHTE+P + Sbjct: 523 VCVSIYFAFEHTERPSD 539 >08_02_0030 + 11380149-11380721,11380800-11381073,11381281-11382449 Length = 671 Score = 26.2 bits (55), Expect = 7.6 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 241 NITAIPKTKMAKLTITCGKIAIHKF 315 N P T++ KLT C + +HKF Sbjct: 410 NKRPFPTTEVVKLTEHCSNVILHKF 434 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,995,501 Number of Sequences: 37544 Number of extensions: 108196 Number of successful extensions: 232 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 227 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 232 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 542368620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -