BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30287 (358 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 1.1 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 22 1.9 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 22 1.9 AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter... 21 5.8 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 20 7.6 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 1.1 Identities = 11/41 (26%), Positives = 22/41 (53%) Frame = +2 Query: 53 ESVWFMKEHTEKPGNFVTF*WIKSLERFFLKNLYENIKSNQ 175 E +W + + TEK + + + W ER+ ++Y N++ Q Sbjct: 1090 EEMWELID-TEKLTDRLPYPWTMDNERYVKVDMYMNLEGEQ 1129 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 240 KYYCYSKNKNGKVNH 284 +Y C ++N+ GKV H Sbjct: 496 EYSCMAENRAGKVTH 510 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/15 (46%), Positives = 11/15 (73%) Frame = +3 Query: 240 KYYCYSKNKNGKVNH 284 +Y C ++N+ GKV H Sbjct: 496 EYSCMAENRAGKVTH 510 >AY395073-1|AAQ96729.1| 203|Apis mellifera GABA neurotransmitter transporter-1A protein. Length = 203 Score = 20.6 bits (41), Expect = 5.8 Identities = 5/7 (71%), Positives = 6/7 (85%) Frame = -2 Query: 276 LCHFCFW 256 LC+FC W Sbjct: 186 LCYFCIW 192 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 20.2 bits (40), Expect = 7.6 Identities = 7/20 (35%), Positives = 12/20 (60%) Frame = +3 Query: 231 CFLKYYCYSKNKNGKVNHHL 290 C L+ + KNGK+ ++L Sbjct: 74 CVLEKFNVMDKKNGKIRYNL 93 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 84,968 Number of Sequences: 438 Number of extensions: 1595 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -