BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30286 (418 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) seve... 125 1e-29 At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) 123 4e-29 At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) 123 4e-29 At5g26190.1 68418.m03116 DC1 domain-containing protein contains ... 28 2.2 At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-r... 27 5.1 >At3g56340.1 68416.m06264 40S ribosomal protein S26 (RPS26C) several 40S ribosomal protein S26 Length = 130 Score = 125 bits (302), Expect = 1e-29 Identities = 53/76 (69%), Positives = 63/76 (82%) Frame = +2 Query: 26 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 205 MT KRRNGGR KH RGHVK +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVKPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 206 MFQLPKLYAKLHYCVS 253 + LPKLYAK YCVS Sbjct: 61 GYTLPKLYAKTQYCVS 76 Score = 36.7 bits (81), Expect = 0.006 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +1 Query: 256 AIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 363 AIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 78 AIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPAQ 113 >At2g40590.1 68415.m05007 40S ribosomal protein S26 (RPS26B) Length = 131 Score = 123 bits (297), Expect = 4e-29 Identities = 52/76 (68%), Positives = 62/76 (81%) Frame = +2 Query: 26 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 205 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 206 MFQLPKLYAKLHYCVS 253 + LPKLYAK YCVS Sbjct: 61 GYTLPKLYAKTQYCVS 76 Score = 35.5 bits (78), Expect = 0.014 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +1 Query: 256 AIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 363 AIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 78 AIHSHVVRVRSRTNRRVRTPPPRFTRRKEDTPKPGQ 113 >At2g40510.1 68415.m04999 40S ribosomal protein S26 (RPS26A) Length = 133 Score = 123 bits (297), Expect = 4e-29 Identities = 52/76 (68%), Positives = 62/76 (81%) Frame = +2 Query: 26 MTRKRRNGGRAKHGRGHVKAVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYP 205 MT KRRNGGR KH RGHV +RC+NC +C PKDKAIK+F++RNIVE AA+RD+ +ASVY Sbjct: 1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYE 60 Query: 206 MFQLPKLYAKLHYCVS 253 + LPKLYAK YCVS Sbjct: 61 GYTLPKLYAKTQYCVS 76 Score = 35.5 bits (78), Expect = 0.014 Identities = 18/36 (50%), Positives = 22/36 (61%) Frame = +1 Query: 256 AIHSKVVRNRSKKDRRIRTPPKSNFPRDMSRPQAVQ 363 AIHS VVR RS+ +RR+RTPP R P+ Q Sbjct: 78 AIHSHVVRVRSRTNRRVRTPPPRFARRKEDTPKPGQ 113 >At5g26190.1 68418.m03116 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 556 Score = 28.3 bits (60), Expect = 2.2 Identities = 15/53 (28%), Positives = 21/53 (39%) Frame = +2 Query: 188 DASVYPMFQLPKLYAKLHYCVSSPSTAKLSGTDRRKTEESVLLPRVTSLGTCH 346 D S YP L + C+ PS ++ D R + +L P G CH Sbjct: 149 DNSSYPCTCLQCCFIIHRDCIDLPSVISINRHDHRISHVDILRPEEWICGVCH 201 >At1g52450.1 68414.m05921 ubiquitin carboxyl-terminal hydrolase-related contains Pfam profiles PF00443: Ubiquitin carboxyl-terminal hydrolase, PF04780: Protein of unknown function (DUF629), PF04781: Protein of unknown function (DUF627) Length = 1136 Score = 27.1 bits (57), Expect = 5.1 Identities = 13/48 (27%), Positives = 23/48 (47%) Frame = +2 Query: 83 AVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDINDASVYPMFQLPKL 226 ++ C C VP+ +K + AVRD+ + ++ P F +P L Sbjct: 572 SILCDRCEEIVPEISLARKIFV------CAVRDVFEGALLPTFDVPDL 613 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,605,251 Number of Sequences: 28952 Number of extensions: 133612 Number of successful extensions: 386 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 385 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 635399168 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -