BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30285 (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 26 3.0 SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|... 26 3.0 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/28 (42%), Positives = 15/28 (53%) Frame = -2 Query: 502 HRSTRMHRTSYPLGHDFAFRLPISH*TV 419 HR+ R HR SY D+ R P H +V Sbjct: 110 HRTPRHHRRSYSPRSDYGSRSPSPHSSV 137 >SPAC1250.01 |snf21|SPAC29A4.21|ATP-dependent DNA helicase Snf21|Schizosaccharomyces pombe|chr 1|||Manual Length = 1199 Score = 26.2 bits (55), Expect = 3.0 Identities = 12/32 (37%), Positives = 16/32 (50%) Frame = +2 Query: 368 YVQKTCIHSTKIIVATPYCSMRNRKTKRKVVA 463 Y+Q C H +I V T R +K R V+A Sbjct: 271 YLQTVCAHGREINVRTKNAQARAQKANRAVLA 302 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,510,159 Number of Sequences: 5004 Number of extensions: 21706 Number of successful extensions: 35 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 35 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 35 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -