BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30284 (536 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7... 27 0.53 DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. 23 4.9 AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14... 23 4.9 DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. 23 8.6 AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 23 8.6 >L20837-1|AAA03087.1| 192|Anopheles gambiae ribosomal protein S7 protein. Length = 192 Score = 26.6 bits (56), Expect = 0.53 Identities = 25/75 (33%), Positives = 39/75 (52%), Gaps = 3/75 (4%) Frame = +1 Query: 253 FAGKHCVYVYRAKKRTPIPGGPRGKKTKLRAIWGKVTRPHG-NSGSVRAKFKSNL--PAQ 423 F+GKH V++ A++R +P RG++ K RP N +V +L PA+ Sbjct: 85 FSGKHVVFI--AERRI-LPKPMRGRRDP-----NKQKRPRSPNVTAVYDAILEDLVFPAE 136 Query: 424 AMGHRIRVMLYPSRI 468 +G RIRV L S++ Sbjct: 137 VVGKRIRVKLDGSQL 151 >DQ383819-1|ABD38144.1| 377|Anopheles gambiae abdominal-B protein. Length = 377 Score = 23.4 bits (48), Expect = 4.9 Identities = 10/32 (31%), Positives = 15/32 (46%) Frame = +1 Query: 367 PHGNSGSVRAKFKSNLPAQAMGHRIRVMLYPS 462 P GN + + + P A+ I+ M YPS Sbjct: 149 PWGNDSAADYAYHAQYPPYALATDIKPMYYPS 180 >AF117748-1|AAD38334.1| 365|Anopheles gambiae serine protease 14A protein. Length = 365 Score = 23.4 bits (48), Expect = 4.9 Identities = 12/44 (27%), Positives = 23/44 (52%) Frame = +2 Query: 119 ASKPRHGRLYAKAVFTGYKRGLRNQHENTALLKVEGAKDRNDAV 250 A P++ + A+ V GY + QH + AL++++ N+ V Sbjct: 196 ADPPQNFGIEAQIVHPGYDKNGPYQHHDIALIRLDRDVTMNNFV 239 >DQ974164-1|ABJ52804.1| 410|Anopheles gambiae serpin 4C protein. Length = 410 Score = 22.6 bits (46), Expect = 8.6 Identities = 9/32 (28%), Positives = 14/32 (43%) Frame = -1 Query: 353 PQIARSLVFLPRGPPGIGVLFLALYT*TQCLP 258 P R+ F P GP G + + + C+P Sbjct: 130 PMATRNRRFFPNGPEGPDSFDIPMMAKSHCMP 161 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 22.6 bits (46), Expect = 8.6 Identities = 17/81 (20%), Positives = 31/81 (38%) Frame = +3 Query: 117 KHQSPATAGCTQRPYSQDISVVYATSTRTPLSSRLKEQKTVMMQSFCWQALRLCVQS*EE 296 ++Q P TA C R + Q + T R + +MQ F ++ ++ Sbjct: 213 RNQQPPTADCCTRAFKQ-----FFTCLRPDFEQFFIRNRETVMQHFLYKT--------DQ 259 Query: 297 DTNSRRSPWQKNQAACYLGQG 359 R+ PW + C++ G Sbjct: 260 PAEDRQPPWCRTM--CWIRSG 278 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 510,053 Number of Sequences: 2352 Number of extensions: 11196 Number of successful extensions: 40 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 40 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 40 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -