BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30283 (516 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) 142 1e-34 SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) 28 5.3 SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 28 5.3 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 27 6.9 SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.9 >SB_6482| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 142 bits (345), Expect = 1e-34 Identities = 63/79 (79%), Positives = 76/79 (96%) Frame = +2 Query: 17 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 196 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IKGVGRRY+NIV KKADID++KRAGE T Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIKGVGRRYANIVCKKADIDMNKRAGELT 60 Query: 197 EEEVEKIITIMSNPRQYKI 253 E+EVE+++TIM NPRQYKI Sbjct: 61 EDEVERVVTIMQNPRQYKI 79 Score = 106 bits (255), Expect = 9e-24 Identities = 45/55 (81%), Positives = 51/55 (92%) Frame = +1 Query: 256 DWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAHRGMRHYWGLRVRGQH 420 DWFLNRQKD DGKYSQ+ ++ LD+K+REDLERLKKIRAHRG+RHYWGLRVRGQH Sbjct: 81 DWFLNRQKDHKDGKYSQILANGLDNKMREDLERLKKIRAHRGLRHYWGLRVRGQH 135 >SB_49538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 66.1 bits (154), Expect = 2e-11 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = +2 Query: 17 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIK 118 MSLVIP+KFQHILR++NTNIDGK+K+MFAMT+IK Sbjct: 1 MSLVIPEKFQHILRVLNTNIDGKQKIMFAMTSIK 34 >SB_48733| Best HMM Match : RVT_1 (HMM E-Value=5.2e-05) Length = 1104 Score = 27.9 bits (59), Expect = 5.3 Identities = 10/37 (27%), Positives = 23/37 (62%) Frame = -1 Query: 207 TSSSVHSPARLSRSMSAFLRTMLEYLRPTPLIAVIAN 97 T +++HS + ++++ F+ + +E RPT L ++ N Sbjct: 826 TDTALHSKGKDNKTLDLFVSSRVEKYRPTKLHEIVGN 862 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 27.9 bits (59), Expect = 5.3 Identities = 17/61 (27%), Positives = 30/61 (49%) Frame = +2 Query: 38 KFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECTEEEVEKI 217 +F+H ++ + KRK + + +NI K DIDL G CTE+E+ ++ Sbjct: 59 EFRHEVQASTRKVSSKRKPIRKRRTVT------ANISATKYDIDL---LGYCTEQEIRRV 109 Query: 218 I 220 + Sbjct: 110 V 110 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/32 (40%), Positives = 20/32 (62%) Frame = +1 Query: 265 LNRQKDIVDGKYSQLTSSNLDSKLREDLERLK 360 L R+K + + KY + +N D K RE++E LK Sbjct: 873 LRREKKVFE-KYQKAARANPDKKEREEIESLK 903 >SB_30168| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6863 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 286 VDGKYSQLTSSNLD-SKLREDLERLKKIRAHRGMR 387 V+ KY + S + + + LRE+LE +KK+R G++ Sbjct: 2765 VENKYKEKASDSANVAVLREELEDIKKLRQDMGIQ 2799 >SB_3781| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 499 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/23 (56%), Positives = 18/23 (78%), Gaps = 2/23 (8%) Frame = +1 Query: 304 QLTSS--NLDSKLREDLERLKKI 366 QLTS N+D K+RE LE++KK+ Sbjct: 72 QLTSEEDNVDPKIREGLEKIKKL 94 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,641,381 Number of Sequences: 59808 Number of extensions: 297962 Number of successful extensions: 840 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 792 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 840 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1148326654 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -