BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30283 (516 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z99281-11|CAB16517.1| 154|Caenorhabditis elegans Hypothetical p... 123 9e-29 Z81457-5|CAB03817.2| 584|Caenorhabditis elegans Hypothetical pr... 31 0.65 U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical pr... 27 8.0 >Z99281-11|CAB16517.1| 154|Caenorhabditis elegans Hypothetical protein Y57G11C.16 protein. Length = 154 Score = 123 bits (296), Expect = 9e-29 Identities = 54/79 (68%), Positives = 69/79 (87%) Frame = +2 Query: 17 MSLVIPDKFQHILRIMNTNIDGKRKVMFAMTAIKGVGRRYSNIVLKKADIDLDKRAGECT 196 MSL+IP+KFQHI R+MNTNIDG RKV +A+TAIKGVGRR++ + +KAD+D++KRAGE T Sbjct: 1 MSLIIPEKFQHIHRVMNTNIDGNRKVPYALTAIKGVGRRFAFVCCRKADVDVNKRAGELT 60 Query: 197 EEEVEKIITIMSNPRQYKI 253 EE+ +KI+TIM NP QYKI Sbjct: 61 EEDFDKIVTIMQNPSQYKI 79 Score = 100 bits (239), Expect = 7e-22 Identities = 43/55 (78%), Positives = 49/55 (89%) Frame = +1 Query: 256 DWFLNRQKDIVDGKYSQLTSSNLDSKLREDLERLKKIRAHRGMRHYWGLRVRGQH 420 +WFLNRQKDI DGK QL S+ +D+KLREDLER+KKIR HRG+RHYWGLRVRGQH Sbjct: 81 NWFLNRQKDIKDGKTGQLLSTAVDNKLREDLERMKKIRLHRGLRHYWGLRVRGQH 135 >Z81457-5|CAB03817.2| 584|Caenorhabditis elegans Hypothetical protein C01G12.7 protein. Length = 584 Score = 30.7 bits (66), Expect = 0.65 Identities = 17/45 (37%), Positives = 24/45 (53%) Frame = +2 Query: 338 VKIWRGSRRFALTEGCDITGAFVCVVSTLRLLAGEEELLVYQRRS 472 +K +R + AL +TGA + + +TL LLA LL QR S Sbjct: 137 IKKYRWGMKMALLFHLCVTGALLSITNTLHLLASGYHLLKRQRNS 181 >U97006-1|AAC47965.1| 2076|Caenorhabditis elegans Hypothetical protein C13F10.4 protein. Length = 2076 Score = 27.1 bits (57), Expect = 8.0 Identities = 9/17 (52%), Positives = 11/17 (64%) Frame = +1 Query: 100 CDDGYQRCWPEVLQHCS 150 C + YQ CWP +L CS Sbjct: 1512 CREYYQICWPPILLACS 1528 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,944,580 Number of Sequences: 27780 Number of extensions: 227968 Number of successful extensions: 707 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 690 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 707 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 996506972 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -