BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30282X (314 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) 36 0.007 SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) 34 0.028 SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) 33 0.049 SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) 28 1.8 SB_33499| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.2 SB_6378| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) 26 5.6 SB_3214| Best HMM Match : Keratin_B2 (HMM E-Value=0.096) 26 5.6 SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.4 SB_26480| Best HMM Match : EGF (HMM E-Value=0) 26 7.4 SB_58559| Best HMM Match : AA_permease (HMM E-Value=1.5e-07) 25 9.8 SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) 25 9.8 >SB_38764| Best HMM Match : CBM_14 (HMM E-Value=1.5e-10) Length = 155 Score = 35.9 bits (79), Expect = 0.007 Identities = 20/54 (37%), Positives = 30/54 (55%) Frame = +3 Query: 60 IASNMKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 221 ++S+MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 46 MSSDMKSLVLLIACFSVARATEDDFCKER-DAGC--YVDLKDCSKYY-QCDDFH 95 >SB_19839| Best HMM Match : Ery_res_leader2 (HMM E-Value=9.9) Length = 117 Score = 33.9 bits (74), Expect = 0.028 Identities = 18/41 (43%), Positives = 24/41 (58%) Frame = +2 Query: 80 VCSHRCLSGSGCAGRGRLMLSERRPRMQTDFKSAALQRVLR 202 V SH LSG GC G+GR + E++ R +A LQ +LR Sbjct: 56 VWSHLHLSGGGC-GKGRHLPKEKQSRGSPPISAALLQHILR 95 >SB_27121| Best HMM Match : CBM_14 (HMM E-Value=5.8e-29) Length = 339 Score = 33.1 bits (72), Expect = 0.049 Identities = 19/50 (38%), Positives = 26/50 (52%) Frame = +3 Query: 72 MKVYALIVACLALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDNH 221 MK L++AC ++ E+D C + D GC + L CS YY Q D H Sbjct: 1 MKSLVLLIACFSVARATEDDYCKER-DAGC--YVDLKDCSKYY-QCDDFH 46 >SB_10903| Best HMM Match : Aldolase_II (HMM E-Value=9.1e-17) Length = 280 Score = 27.9 bits (59), Expect = 1.8 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +2 Query: 71 YEGVCSHRCLSGSGCAGRGRLML 139 +EGVC+H + G G GR+ML Sbjct: 63 HEGVCNHLSMMAPGKHGTGRVML 85 >SB_33499| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 486 Score = 27.1 bits (57), Expect = 3.2 Identities = 9/31 (29%), Positives = 19/31 (61%) Frame = +2 Query: 11 HTSNALVIFSRIRH*INRIKYEGVCSHRCLS 103 H + +F R+ H NR++Y+G ++ C++ Sbjct: 369 HVRHEASLFGRMNHYENRVEYKGFTANICIA 399 >SB_6378| Best HMM Match : Keratin_B2 (HMM E-Value=0.1) Length = 269 Score = 26.2 bits (55), Expect = 5.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 74 EGVCSHRCLSGSGCAGR 124 + C HRC+ G C GR Sbjct: 174 QSCCGHRCVFGKSCYGR 190 >SB_3214| Best HMM Match : Keratin_B2 (HMM E-Value=0.096) Length = 191 Score = 26.2 bits (55), Expect = 5.6 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +2 Query: 74 EGVCSHRCLSGSGCAGR 124 + C HRC+ G C GR Sbjct: 96 QSCCGHRCVFGKSCYGR 112 >SB_31643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 330 Score = 25.8 bits (54), Expect = 7.4 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +3 Query: 93 VACL-ALGVLAEEDSCYQNVDQGCRRTLSLPHCSAYYGQFKDN 218 V CL A+G++A+ S +VDQ C + C ++Y N Sbjct: 7 VLCLCAIGLVAKAQSDCVDVDQQCSFWANSGFCKSHYDYMSKN 49 >SB_26480| Best HMM Match : EGF (HMM E-Value=0) Length = 1772 Score = 25.8 bits (54), Expect = 7.4 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = +2 Query: 68 KYEGVCSHRCLSG 106 K++ VCSHRC SG Sbjct: 316 KFDQVCSHRCPSG 328 >SB_58559| Best HMM Match : AA_permease (HMM E-Value=1.5e-07) Length = 530 Score = 25.4 bits (53), Expect = 9.8 Identities = 9/20 (45%), Positives = 14/20 (70%) Frame = +3 Query: 201 GQFKDNHVVANGLKGLASCI 260 GQF +N++ N +GL SC+ Sbjct: 21 GQFGENYIWTNQRRGLESCL 40 >SB_8981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1726 Score = 25.4 bits (53), Expect = 9.8 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -3 Query: 177 DLKSVCILGRRSDSMSLPRPA 115 D + +CI+ R++D S P+P+ Sbjct: 813 DAEGICIIRRKNDLTSAPKPS 833 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,641,388 Number of Sequences: 59808 Number of extensions: 177037 Number of successful extensions: 388 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 388 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 400488992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -