BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30282X (314 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g50890.1 68414.m05722 expressed protein 27 3.5 At3g46810.1 68416.m05081 DC1 domain-containing protein contains ... 26 4.6 At2g37880.1 68415.m04650 expressed protein contains Pfam profile... 26 4.6 At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR... 26 6.1 At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family pr... 25 8.1 At4g17430.1 68417.m02609 expressed protein weak similarity to Ci... 25 8.1 At1g47570.1 68414.m05281 zinc finger (C3HC4-type RING finger) fa... 25 8.1 >At1g50890.1 68414.m05722 expressed protein Length = 821 Score = 26.6 bits (56), Expect = 3.5 Identities = 7/19 (36%), Positives = 10/19 (52%) Frame = +1 Query: 106 LWVCWPRKTHAIRTSTKDA 162 +W CW HA+R D+ Sbjct: 679 IWTCWSNSVHALRVGDTDS 697 >At3g46810.1 68416.m05081 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 686 Score = 26.2 bits (55), Expect = 4.6 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = -2 Query: 274 VGTFQIHEANPLSPFATTWLS 212 + +++HE +PL PF T WL+ Sbjct: 117 IENYKVHE-HPLKPFKTAWLA 136 >At2g37880.1 68415.m04650 expressed protein contains Pfam profile PF04759: Protein of unknown function, DUF617 Length = 247 Score = 26.2 bits (55), Expect = 4.6 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 1/28 (3%) Frame = +1 Query: 79 CMLSSLPVWLWVCWPRKT-HAIRTSTKD 159 C+L S+PVW C RK A+R S + Sbjct: 143 CLLRSVPVWTMFCNGRKLGFAVRRSANE 170 >At1g27180.1 68414.m03311 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1556 Score = 25.8 bits (54), Expect = 6.1 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = +3 Query: 156 GCRRTLSLPHCSAYYGQFKDNHVVANGLKGLASCI 260 GCR LP C Y +D ++ L+ L S I Sbjct: 970 GCRSIEELPSCVGYLTSLEDLYLDDTALRNLPSSI 1004 >At5g41315.1 68418.m05021 basic helix-loop-helix (bHLH) family protein contains Pfam profile: PF00010 helix-loop-helix DNA-binding domain ;annotation temporarily based on supporting cDNA gi|17224394|gb|AF246291.1|AF246291 Length = 637 Score = 25.4 bits (53), Expect = 8.1 Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 7/82 (8%) Frame = +2 Query: 83 CSHRCLSGSGCAGR-------GRLMLSERRPRMQTDFKSAALQRVLRPIQGQPRCSERT* 241 C H+ L+ S C + GR+ R+ R+Q + QR ++ + PR + Sbjct: 300 CVHQSLNSSDCVSQTFVEGAAGRVAYGARKSRVQRLGQIQEQQRNVKTLSFDPRNDDVHY 359 Query: 242 RISLMYLKRSYHYLLSGS*FNN 307 + + + ++ H L+ G F N Sbjct: 360 QSVISTIFKTNHQLILGPQFRN 381 >At4g17430.1 68417.m02609 expressed protein weak similarity to CigA protein [Mucor circinelloides] GI:9717020 Length = 507 Score = 25.4 bits (53), Expect = 8.1 Identities = 13/40 (32%), Positives = 18/40 (45%), Gaps = 2/40 (5%) Frame = +3 Query: 60 IASNMKVYALIVAC--LALGVLAEEDSCYQNVDQGCRRTL 173 +A + Y + C L GV D C VD+ CR T+ Sbjct: 200 LAEQSQAYESLKQCGYLLSGVRGNVDKCLYAVDEDCRTTV 239 >At1g47570.1 68414.m05281 zinc finger (C3HC4-type RING finger) family protein contains Pfam PF00097: Zinc finger, C3HC4 type (RING finger) Length = 466 Score = 25.4 bits (53), Expect = 8.1 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = -3 Query: 186 SAADLKSVCILG-RRSDSMSLPRPAHPEPDRQR 91 S+A ++S I+G +R +++P P H E D R Sbjct: 221 SSASIQSNLIIGSKRKRRLNMPAPTHEERDSLR 253 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,601,338 Number of Sequences: 28952 Number of extensions: 121926 Number of successful extensions: 272 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 330493944 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -