BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30281 (709 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1039.06 |||alanine racemase |Schizosaccharomyces pombe|chr 1... 27 2.0 SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyc... 27 2.6 SPBC19G7.08c |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual 27 3.5 SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyce... 26 4.6 SPAC29E6.06c ||SPAC30.10c|cysteine-tRNA ligase |Schizosaccharomy... 26 6.1 SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces p... 25 8.0 SPBC1709.16c |||aromatic ring-opening dioxygenase |Schizosacchar... 25 8.0 >SPAC1039.06 |||alanine racemase |Schizosaccharomyces pombe|chr 1|||Manual Length = 415 Score = 27.5 bits (58), Expect = 2.0 Identities = 18/61 (29%), Positives = 28/61 (45%), Gaps = 1/61 (1%) Frame = +3 Query: 138 NVYRSLGVQCNAESKIASTT-KFCTEKLCGQKLCTRTSNKVATRSQPTLRERLMAPAGPN 314 +++ G C+A AS + +E LC + T+ K AT P+L+ L A P Sbjct: 196 SLFDLFGFYCHAGHSYASRSIDAASEFLCAEIDAANTAAKFATSIDPSLKLTLSVGATPT 255 Query: 315 A 317 A Sbjct: 256 A 256 >SPBC2D10.17 |clr1||cryptic loci regulator Clr1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1238 Score = 27.1 bits (57), Expect = 2.6 Identities = 12/53 (22%), Positives = 28/53 (52%) Frame = -2 Query: 561 IHPFLATKFRSAGVLKTALHYQQSAPKNPRCIHMLFLYVLSHIVAKGEIPEEY 403 + PFL ++ +L + + +S P PR L L ++ + + KG++ +++ Sbjct: 355 VSPFLTPDNIASSILYSTASFSRSKPDRPRLNLSLELKLMQNELNKGQLKKQF 407 >SPBC19G7.08c |||arrestin|Schizosaccharomyces pombe|chr 2|||Manual Length = 483 Score = 26.6 bits (56), Expect = 3.5 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 175 SLKSPVPQNFVPRNYVVRNYAREPRTRSLHAHN 273 S+KSP P + +++V +YA + S+H HN Sbjct: 115 SIKSPPPS--LTSDWIVDSYASDQDNPSVHTHN 145 >SPBC20F10.08c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 747 Score = 26.2 bits (55), Expect = 4.6 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -3 Query: 164 LNAERPIHIRDNIINSENVYVYFNRI 87 +N R +H+ N++ EN YV+ N I Sbjct: 557 INPVRVLHVLINLLRDENSYVHLNVI 582 >SPAC29E6.06c ||SPAC30.10c|cysteine-tRNA ligase |Schizosaccharomyces pombe|chr 1|||Manual Length = 754 Score = 25.8 bits (54), Expect = 6.1 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 574 DNNGHPSISCYQI*KCGCSENSTALPAV 491 D NGHP+ + K SEN+ A+P + Sbjct: 564 DENGHPNAVGWSSSKGSSSENTDAMPYI 591 >SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 505 Score = 25.4 bits (53), Expect = 8.0 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 405 TLQESHLWPQYVKERIKTTYGYIAGSLVLTAGSAVLFSE 521 T+QE+ +K++ + T+ + GSL LT G V+ + Sbjct: 464 TIQEAIETVMSIKQKSRNTFVCVTGSLHLTGGVFVVLDQ 502 >SPBC1709.16c |||aromatic ring-opening dioxygenase |Schizosaccharomyces pombe|chr 2|||Manual Length = 285 Score = 25.4 bits (53), Expect = 8.0 Identities = 9/20 (45%), Positives = 13/20 (65%) Frame = -2 Query: 555 PFLATKFRSAGVLKTALHYQ 496 PFL KFR G++ + HY+ Sbjct: 53 PFLLEKFRPKGIIVFSAHYE 72 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,103,217 Number of Sequences: 5004 Number of extensions: 67492 Number of successful extensions: 190 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 176 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 329179816 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -