BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30281 (709 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17894| Best HMM Match : UPF0005 (HMM E-Value=0.00021) 56 3e-08 SB_54605| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.23 SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) 30 2.1 SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) 29 4.9 SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) 29 4.9 SB_41963| Best HMM Match : Metallothio (HMM E-Value=3.7) 28 6.5 SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.5 >SB_17894| Best HMM Match : UPF0005 (HMM E-Value=0.00021) Length = 344 Score = 56.0 bits (129), Expect = 3e-08 Identities = 32/74 (43%), Positives = 42/74 (56%), Gaps = 4/74 (5%) Frame = +3 Query: 375 CYYGSGVKP--GTLQESHLWPQYVKERIKTTYGYIAGSLVLTAGSAVLFSEHPHF*IW*Q 548 CYYG G+ G + S +WPQ V++RI TY Y AGSL +TAG+A S ++ Sbjct: 129 CYYGLGLSSEVGAIDRSVMWPQVVRDRIHATYAYFAGSLAVTAGAAYSISRSRA--VY-T 185 Query: 549 EMDGCPLL--SHWV 584 M PLL +HWV Sbjct: 186 MMRASPLLLTAHWV 199 >SB_54605| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 911 Score = 33.1 bits (72), Expect = 0.23 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 1/43 (2%) Frame = +2 Query: 344 WSL-CSWTSCSVLLWLWGKTRYSSGISPLATICERTYKNNIWI 469 W++ C W + + W +GK ++P T+ E Y NNI I Sbjct: 217 WNIDCQWIDVTDMAWKFGKFYLRIVVNPNRTVAETDYDNNIGI 259 >SB_13207| Best HMM Match : Extensin_2 (HMM E-Value=0.061) Length = 2735 Score = 29.9 bits (64), Expect = 2.1 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 682 SHNTSVRHPC*LFSPKSRCVLHSSYYHARTNHQTQCDN 569 SH+T V HP + P+ V H S Y +H Q D+ Sbjct: 1587 SHDTFVVHPSAAYEPRGSTVSHESNYIGIPSHVEQYDD 1624 >SB_48544| Best HMM Match : TSP_1 (HMM E-Value=3.1e-32) Length = 326 Score = 28.7 bits (61), Expect = 4.9 Identities = 19/43 (44%), Positives = 23/43 (53%), Gaps = 2/43 (4%) Frame = +2 Query: 305 WTKCIQLGQGCI-SWS-LCSWTSCSVLLWLWGKTRYSSGISPL 427 W KC QL + C +W SW+SCSV L KTR +PL Sbjct: 187 WGKC-QLQEHCPGNWGEWSSWSSCSVTCDLGTKTRTRKCDNPL 228 >SB_10311| Best HMM Match : S-antigen (HMM E-Value=0.73) Length = 617 Score = 28.7 bits (61), Expect = 4.9 Identities = 16/35 (45%), Positives = 25/35 (71%), Gaps = 1/35 (2%) Frame = -2 Query: 462 MLFLYVLSHIVAKGE-IPEEYLVLPQSHSSTEQLV 361 +L ++VLS++VA+GE E +L Q+HSS QL+ Sbjct: 155 LLSMHVLSNLVARGETYHEAEWILFQAHSSLIQLL 189 >SB_41963| Best HMM Match : Metallothio (HMM E-Value=3.7) Length = 167 Score = 28.3 bits (60), Expect = 6.5 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 6/34 (17%) Frame = +2 Query: 302 CWTKC-IQLGQGC--ISWSLCS---WTSCSVLLW 385 CWTKC I G C + + C+ WT C+++ W Sbjct: 98 CWTKCAIVHGTKCAIVHGTKCAIVCWTKCAIVCW 131 >SB_55491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 27.9 bits (59), Expect = 8.5 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%) Frame = +3 Query: 183 IASTTKFCTEK---LCGQKLCTRTSNKVATRSQPTL 281 I +T FCT K +C Q CT+T T+ +P + Sbjct: 153 IPGSTGFCTSKESVICTQLWCTKTDLSCTTKVEPAV 188 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,464,241 Number of Sequences: 59808 Number of extensions: 525145 Number of successful extensions: 1578 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1311 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1565 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1865706635 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -