BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30281 (709 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 23 2.1 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 23 2.8 AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-sy... 22 5.0 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 8.7 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 23.4 bits (48), Expect = 2.1 Identities = 10/22 (45%), Positives = 14/22 (63%) Frame = +3 Query: 189 STTKFCTEKLCGQKLCTRTSNK 254 S K T +LCG+ LC++ S K Sbjct: 1 SAKKLFTCQLCGKVLCSKASLK 22 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 23.0 bits (47), Expect = 2.8 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +1 Query: 601 HGSKRNGVHTW 633 HG KR+G H+W Sbjct: 697 HGIKRSGSHSW 707 >AB244761-1|BAE66603.1| 504|Apis mellifera cystathionine beta-synthase protein. Length = 504 Score = 22.2 bits (45), Expect = 5.0 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +3 Query: 432 QYVKERIKTTYGYIAGSLVLTAGSAVLFSEH 524 QYVK + T GYI+ L +L EH Sbjct: 445 QYVKVKHSATLGYISRVLEKEPYVIILDDEH 475 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.4 bits (43), Expect = 8.7 Identities = 6/16 (37%), Positives = 14/16 (87%) Frame = +2 Query: 560 MSIIVTLGLMIGSGMV 607 +++++TLG+ I SG++ Sbjct: 403 LALVITLGIAIVSGLI 418 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,447 Number of Sequences: 438 Number of extensions: 5076 Number of successful extensions: 8 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21804885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -