BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30281 (709 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g43740.1 68415.m05437 hypothetical protein weak similarity to... 29 2.3 At1g33410.1 68414.m04136 expressed protein 27 9.2 >At2g43740.1 68415.m05437 hypothetical protein weak similarity to RTM1 (GI:6503088) [Arabidopsis thaliana] Length = 309 Score = 29.5 bits (63), Expect = 2.3 Identities = 13/43 (30%), Positives = 24/43 (55%) Frame = -2 Query: 630 GVYSIPLTTMPEPIIRPNVTIMDIHPFLATKFRSAGVLKTALH 502 G+Y P+T + + +R N + D + +T ++S+G L T H Sbjct: 185 GIYVCPITRINDVALRTNYKVTDDYDDQSTFYQSSGPLTTINH 227 >At1g33410.1 68414.m04136 expressed protein Length = 1459 Score = 27.5 bits (58), Expect = 9.2 Identities = 13/30 (43%), Positives = 19/30 (63%) Frame = +2 Query: 374 VLLWLWGKTRYSSGISPLATICERTYKNNI 463 V LWL GK Y SGI PLA + ++ +++ Sbjct: 278 VRLWL-GKADYDSGIIPLAVLYRKSMNDSM 306 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,111,989 Number of Sequences: 28952 Number of extensions: 352446 Number of successful extensions: 1062 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1017 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1062 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1526202912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -