BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30279 (646 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0190 + 12832559-12832916,12833012-12833092,12833262-12833305 29 4.2 10_06_0140 + 11147019-11147791,11148301-11150524 27 9.7 >06_02_0190 + 12832559-12832916,12833012-12833092,12833262-12833305 Length = 160 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/52 (28%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +1 Query: 259 YTFKIRYNNKLFCGFGIESDVLFRSWGMRLRHQH-HLVCN*DFMCNIESNKY 411 Y F N CGF + + RS ++L+++ +VC F+ N+E+ Y Sbjct: 58 YRFDAAKNEHYVCGFAKSVESIPRSIYLKLKYETVDVVCMKSFLVNLEARLY 109 >10_06_0140 + 11147019-11147791,11148301-11150524 Length = 998 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/71 (25%), Positives = 38/71 (53%), Gaps = 3/71 (4%) Frame = +1 Query: 94 HDRFSLDTNLNSSAKLIN-SLITPLMTVL*PRIQ-CYTRNVILCFFIYELLLFSSFNYTF 267 H R SLD ++S +L+N S+I P+ ++ C T ++L F +++ + + + + Sbjct: 440 HHRSSLDVAIDSFEELVNRSIIQPVDVSSNTEVKTCQTHGMMLEFILHKSICDNFITFLY 499 Query: 268 -KIRYNNKLFC 297 + R +K+ C Sbjct: 500 GQARLPDKIRC 510 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,293,546 Number of Sequences: 37544 Number of extensions: 268255 Number of successful extensions: 453 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 445 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 453 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1596695220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -