BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30279 (646 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) 28 7.5 SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 SB_1031| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.9 >SB_47303| Best HMM Match : CPSF_A (HMM E-Value=0) Length = 1291 Score = 27.9 bits (59), Expect = 7.5 Identities = 16/48 (33%), Positives = 31/48 (64%) Frame = +3 Query: 447 IFKIFLEFFLSIYSQLLIMFL*NSSAVLLHITVYLVIIVCYYKRSVKI 590 +F + + F++++S ++I+F+ S ++L ITV+ VII+ SV I Sbjct: 1111 VFSVII-LFITVFS-VIILFITVFSVIILFITVFSVIILFITVFSVTI 1156 >SB_21113| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.5 bits (58), Expect = 9.9 Identities = 7/21 (33%), Positives = 16/21 (76%) Frame = +3 Query: 288 TILWVWYRVRCLVSLLGNEIA 350 T+ WV+Y + +++++GN +A Sbjct: 72 TVYWVFYNIIAIITIIGNSLA 92 >SB_9539| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1642 Score = 27.5 bits (58), Expect = 9.9 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +1 Query: 103 FSLDTNLNSSAKLINSLITPLMTVL*PRIQCYTRNVILCFFIYELLLFSSFNYTFKIRYN 282 FSL +NS++ PL L Y IL F ++ +L+F +F ++ + Y+ Sbjct: 659 FSLACRFTGRGAHVNSILGPLQLSL-----YYLLVDILKFLVFFVLIFMAFGFSLRRLYS 713 Query: 283 N 285 N Sbjct: 714 N 714 >SB_1031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1933 Score = 27.5 bits (58), Expect = 9.9 Identities = 12/19 (63%), Positives = 15/19 (78%) Frame = +3 Query: 540 TVYLVIIVCYYKRSVKIKM 596 TVYLVI+V +Y R +K KM Sbjct: 789 TVYLVIVVIFYFRRLKRKM 807 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,962,471 Number of Sequences: 59808 Number of extensions: 355643 Number of successful extensions: 772 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 723 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 770 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1633044375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -