BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30279 (646 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022972-13|AAC48241.2| 527|Caenorhabditis elegans Udp-glucuron... 29 2.1 U50184-1|ABJ99064.1| 1540|Caenorhabditis elegans Hypothetical pr... 29 3.7 Z81098-7|CAI79193.2| 592|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z81098-6|CAB03180.3| 610|Caenorhabditis elegans Hypothetical pr... 28 4.9 Z99278-6|CAD59170.1| 276|Caenorhabditis elegans Hypothetical pr... 28 6.5 AF068713-18|AAC17791.2| 96|Caenorhabditis elegans Hypothetical... 28 6.5 AF024503-1|AAG24089.2| 527|Caenorhabditis elegans Hypothetical ... 28 6.5 U00048-5|AAB53832.2| 621|Caenorhabditis elegans Hypothetical pr... 27 8.6 U00048-4|AAM15547.1| 751|Caenorhabditis elegans Hypothetical pr... 27 8.6 >AF022972-13|AAC48241.2| 527|Caenorhabditis elegans Udp-glucuronosyltransferase protein41 protein. Length = 527 Score = 29.5 bits (63), Expect = 2.1 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -3 Query: 473 KKFQKYLENKIFLPIRSL*H*YLFDSML 390 K Q+YLE +FLP+ S+ H Y F ++ Sbjct: 156 KAIQEYLEIPVFLPVTSITHDYRFAELI 183 >U50184-1|ABJ99064.1| 1540|Caenorhabditis elegans Hypothetical protein W03A3.2 protein. Length = 1540 Score = 28.7 bits (61), Expect = 3.7 Identities = 11/31 (35%), Positives = 17/31 (54%) Frame = -3 Query: 644 YYFYFYKTSNSTVIALHFNLYRSFIVTNYNH 552 Y YFYK S + +I F +Y FI+ + + Sbjct: 418 YLVYFYKNSRAQIIQKIFKIYSIFILKKFKN 448 >Z81098-7|CAI79193.2| 592|Caenorhabditis elegans Hypothetical protein K07A12.4b protein. Length = 592 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 303 WYRVRCLVSLLGNEIAPSAPSGVQLRLYVQH*IK 404 WY CL+ L+ + +AP PS LR+ + +K Sbjct: 369 WYDGPCLLELIDSFVAPQPPSDGPLRIGISDVLK 402 >Z81098-6|CAB03180.3| 610|Caenorhabditis elegans Hypothetical protein K07A12.4a protein. Length = 610 Score = 28.3 bits (60), Expect = 4.9 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = +3 Query: 303 WYRVRCLVSLLGNEIAPSAPSGVQLRLYVQH*IK 404 WY CL+ L+ + +AP PS LR+ + +K Sbjct: 387 WYDGPCLLELIDSFVAPQPPSDGPLRIGISDVLK 420 >Z99278-6|CAD59170.1| 276|Caenorhabditis elegans Hypothetical protein Y53C12B.5b protein. Length = 276 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/27 (44%), Positives = 17/27 (62%) Frame = +2 Query: 218 VSLSMNFYYFLHLTILLKYVITINYFV 298 VS SM F YFL ++ +VI N+F+ Sbjct: 168 VSNSMIFSYFLEFSLFTNFVIFSNFFI 194 >AF068713-18|AAC17791.2| 96|Caenorhabditis elegans Hypothetical protein T24A6.1 protein. Length = 96 Score = 27.9 bits (59), Expect = 6.5 Identities = 10/33 (30%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +1 Query: 193 CYTRNVILCFFIYELLLFSSFNYT-FKIRYNNK 288 C+ + + L FI+ +F+ N++ F + +NNK Sbjct: 55 CFAKRINLTKFIFSFFMFNKHNFSLFVLTFNNK 87 >AF024503-1|AAG24089.2| 527|Caenorhabditis elegans Hypothetical protein F31F4.7 protein. Length = 527 Score = 27.9 bits (59), Expect = 6.5 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -3 Query: 473 KKFQKYLENKIFLPIRSL*H*Y 408 K Q+YLE +FLP+ SL H Y Sbjct: 156 KAIQEYLEIPVFLPVTSLTHDY 177 >U00048-5|AAB53832.2| 621|Caenorhabditis elegans Hypothetical protein C05D11.7a protein. Length = 621 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 259 YTFKIRYNNKLFCGFGIESDVLFRSWGMRLRHQHH 363 Y F R N++ FG+ +D R + +HQHH Sbjct: 519 YEFHYRDENQVMKTFGLFTDSQQRPYSSASQHQHH 553 >U00048-4|AAM15547.1| 751|Caenorhabditis elegans Hypothetical protein C05D11.7b protein. Length = 751 Score = 27.5 bits (58), Expect = 8.6 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +1 Query: 259 YTFKIRYNNKLFCGFGIESDVLFRSWGMRLRHQHH 363 Y F R N++ FG+ +D R + +HQHH Sbjct: 537 YEFHYRDENQVMKTFGLFTDSQQRPYSSASQHQHH 571 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,931,878 Number of Sequences: 27780 Number of extensions: 296174 Number of successful extensions: 701 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 676 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 701 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1423653030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -