BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30279 (646 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g22130.1 68418.m02576 mannosyltransferase family protein simi... 30 1.5 At3g62970.1 68416.m07074 zinc finger (C3HC4-type RING finger) fa... 29 2.6 At5g15050.1 68418.m01764 glycosyltransferase family 14 protein /... 29 3.5 >At5g22130.1 68418.m02576 mannosyltransferase family protein similar to mannosyltransferase from Rattus norvegicus [GI:11414877], Homo sapiens [GI:11414879]; contains Pfam profile PF05007: Mannosyltransferase (PIG-M) Length = 450 Score = 29.9 bits (64), Expect = 1.5 Identities = 18/72 (25%), Positives = 35/72 (48%) Frame = +1 Query: 82 IYS*HDRFSLDTNLNSSAKLINSLITPLMTVL*PRIQCYTRNVILCFFIYELLLFSSFNY 261 IY H + ++ KLI+ L P TV + C++++++ C F+ + + F +FN Sbjct: 289 IYFYHIYLHYERQFSAVEKLISFL--PQFTVQFALVFCFSQDLVFCIFL-QTVAFVTFNK 345 Query: 262 TFKIRYNNKLFC 297 +Y +C Sbjct: 346 VITAQYFVWFYC 357 >At3g62970.1 68416.m07074 zinc finger (C3HC4-type RING finger) family protein contains Pfam domain PF00097: Zinc finger, C3HC4 type (RING finger) Length = 276 Score = 29.1 bits (62), Expect = 2.6 Identities = 19/57 (33%), Positives = 25/57 (43%), Gaps = 2/57 (3%) Frame = -1 Query: 445 KYSFL*DHYDTNICLIQ--CCT*SLNCTPDGADGAISFPKSETRHRTLYQTHKIVYC 281 K+ F +HY C I+ CC +C D A S P + RH + Q K V C Sbjct: 19 KFQFGCEHYKRR-CKIRAPCCNLIFSCRHCHNDSANSLPDPKERHDLVRQNVKQVVC 74 >At5g15050.1 68418.m01764 glycosyltransferase family 14 protein / core-2/I-branching enzyme family protein contains Pfam profile: PF02485 Core-2/I-Branching enzyme Length = 434 Score = 28.7 bits (61), Expect = 3.5 Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 1/60 (1%) Frame = +1 Query: 229 YELLLFSSFNYTFKIRYNNKLFCGFGIESDVLFRSW-GMRLRHQHHLVCN*DFMCNIESN 405 Y L S Y + N + F + SD+ F SW +H HHL + DF ++SN Sbjct: 293 YANFLSSPEGYFHTVICNAREFTNTTVNSDLHFISWDNPPKQHPHHLTLD-DFQRMVDSN 351 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,514,643 Number of Sequences: 28952 Number of extensions: 248309 Number of successful extensions: 536 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 524 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 536 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1334473344 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -